KEGG   Homo sapiens (human): 51295Help
Entry
51295             CDS       T01001                                 

Gene name
ECSIT, SITPEC
Definition
(RefSeq) ECSIT signalling integrator
  KO
K04405  
evolutionarily conserved signaling intermediate in Toll pathway
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    51295 (ECSIT)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-I assembly factors
    51295 (ECSIT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q9BQ95(Tbio)
UniProt: 
Position
19p13.2
AA seq 431 aa AA seqDB search
MSWVQATLLARGLCRAWGGTCGAALTGTSISQVPRRLPRGLHCSAAAHSSEQSLVPSPPE
PRQRPTKALVPFEDLFGQAPGGERDKASFLQTVQKFAEHSVRKRGHIDFIYLALRKMREY
GVERDLAVYNQLLNIFPKEVFRPRNIIQRIFVHYPRQQECGIAVLEQMENHGVMPNKETE
FLLIQIFGRKSYPMLKLVRLKLWFPRFMNVNPFPVPRDLPQDPVELAMFGLRHMEPDLSA
RVTIYQVPLPKDSTGAADPPQPHIVGIQSPDQQAALARHNPARPVFVEGPFSLWLRNKCV
YYHILRADLLPPEEREVEETPEEWNLYYPMQLDLEYVRSGWDNYEFDINEVEEGPVFAMC
MAGAHDQATMAKWIQGLQETNPTLAQIPVVFRLAGSTRELQTSSAGLEEPPLPEDHQEED
DNLQRQQQGQS
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgagctgggtccaggccaccctactggcccgaggcctctgtagggcctggggaggcacc
tgcggggccgccctcacaggaacctccatctctcaggtccctcgccggctccctcggggc
ctccactgcagcgcagctgcccatagctctgaacagtccctggttcccagcccaccggaa
ccccggcagaggcccaccaaggctctggtgccctttgaggacctgtttgggcaggcgcct
ggtggggaacgggacaaggcgagcttcctgcagacggtgcagaaatttgcggagcacagc
gtgcgtaagcggggccacattgacttcatctacctggccctgcgcaagatgcgggagtat
ggtgtcgagcgggacctggctgtgtacaaccagctgctcaacatcttccccaaggaggtc
ttccggcctcgcaacatcatccagcgcatcttcgtccactaccctcggcagcaggagtgt
gggattgctgtcctggagcagatggagaaccacggtgtgatgcccaacaaggagacggag
ttcctgctgattcagatctttggacgcaaaagctaccccatgctcaagttggtgcgcctg
aagctgtggttccctcgattcatgaacgtcaaccccttcccagtgccccgggacctgccc
caggaccctgtggagctggccatgtttggcctgcggcacatggagcctgaccttagtgcc
agggtcaccatctaccaggttcctttgcccaaagactcaacaggtgcagcagatcccccc
cagccccacatcgtaggaatccagagtcccgatcagcaggccgccctggcccgccacaat
ccagcccggcctgtctttgttgagggccccttctccctgtggctccgcaacaagtgtgtg
tattaccacatcctcagagctgacttgctgcccccggaggagagggaagtggaagagacg
ccggaggagtggaacctctactacccgatgcagctggacctggagtatgtgaggagtggc
tgggacaactacgagtttgacatcaatgaagtggaggaaggccctgtcttcgccatgtgc
atggcgggtgctcatgaccaggcgacgatggctaagtggatccagggcctgcaggagacc
aacccaaccctggcccagatccccgtggtcttccgcctcgccgggtccacccgggagctc
cagacatcctctgcagggctggaggagccgcccctgcccgaggaccaccaggaagaagac
gacaacctgcagcgacagcagcagggccagagctag

DBGET integrated database retrieval system