KEGG   Homo sapiens (human): 513Help
Entry
513               CDS       T01001                                 

Gene name
ATP5D
Definition
(RefSeq) ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit (EC:3.6.1.14)
  KO
K02134  
F-type H+-transporting ATPase subunit delta
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    513 (ATP5D)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    513 (ATP5D)
   05012 Parkinson's disease
    513 (ATP5D)
   05016 Huntington's disease
    513 (ATP5D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.3
AA seq 168 aa AA seqDB search
MLPAALLRRPGLGRLVRHARAYAEAAAAPAAASGPNQMSFTFASPTQVFFNGANVRQVDV
PTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAV
TLDMLDLGAAKANLEKAQAELVGTADEATRAEIQIRIEANEALVKALE
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgctgcccgccgcgctgctccgccgcccgggacttggccgcctcgtccgccacgcccgt
gcctatgccgaggccgccgccgccccggctgccgcctctggccccaaccagatgtccttc
accttcgcctctcccacgcaggtgttcttcaacggtgccaacgtccggcaggtggacgtg
cccacgctgaccggagccttcggcatcctggcggcccacgtgcccacgctgcaggtcctg
cggccggggctggtcgtggtgcatgcagaggacggcaccacctccaaatactttgtgagc
agcggttccatcgcagtgaacgccgactcttcggtgcagttgttggccgaagaggccgtg
acgctggacatgttggacctgggggcagccaaggcaaacttggagaaggcccaggcggag
ctggtggggacagctgacgaggccacgcgggcagagatccagatccgaatcgaggccaac
gaggccctggtgaaggccctggagtag

DBGET integrated database retrieval system