KEGG   Homo sapiens (human): 51302Help
Entry
51302             CDS       T01001                                 

Gene name
CYP39A1
Definition
(RefSeq) cytochrome P450 family 39 subfamily A member 1 (EC:1.14.13.99)
  KO
K07439  
24-hydroxycholesterol 7alpha-hydroxylase [EC:1.14.14.26]
Organism
hsa  Homo sapiens (human)
Pathway
Primary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00120 Primary bile acid biosynthesis
    51302 (CYP39A1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.26  24-hydroxycholesterol 7alpha-hydroxylase
     51302 (CYP39A1)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP39 family
   51302 (CYP39A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p12.3
AA seq 469 aa AA seqDB search
MELISPTVIIILGCLALFLLLQRKNLRRPPCIKGWIPWIGVGFEFGKAPLEFIEKARIKY
GPIFTVFAMGNRMTFVTEEEGINVFLKSKKVDFELAVQNIVYRTASIPKNVFLALHEKLY
IMLKGKMGTVNLHQFTGQLTEELHEQLENLGTHGTMDLNNLVRHLLYPVTVNMLFNKSLF
STNKKKIKEFHQYFQVYDEDFEYGSQLPECLLRNWSKSKKWFLELFEKNIPDIKACKSAK
DNSMTLLQATLDIVETETSKENSPNYGLLLLWASLSNAVPVAFWTLAYVLSHPDIHKAIM
EGISSVFGKAGKDKIKVSEDDLENLLLIKWCVLETIRLKAPGVITRKVVKPVEILNYIIP
SGDLLMLSPFWLHRNPKYFPEPELFKPERWKKANLEKHSFLDCFMAFGSGKFQCPARWFA
LLEVQMCIILILYKYDCSLLDPLPKQSYLHLVGVPQPEGQCRIEYKQRI
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggaactaatttccccaacagtgattataatcctgggttgccttgctctgttcttactc
cttcagcggaagaatttgcgtagacccccgtgcatcaagggctggattccttggattgga
gttggatttgagtttgggaaagcccctctagaatttatagagaaagcaagaatcaagtat
ggaccaatatttacagtctttgctatgggaaaccgaatgacctttgttactgaagaagaa
ggaattaatgtgtttctaaaatccaaaaaagtagattttgaactagcagtgcaaaatatc
gtttatcgtacagcatcaattccaaagaatgtctttttagcactgcatgaaaaactctat
attatgttgaaagggaaaatggggactgtcaatctccatcagtttactgggcaactgact
gaagaattacatgaacaactggagaatttaggcactcatgggacaatggacctgaacaac
ttagtaagacatctcctttatccagtcacagtgaatatgctctttaataaaagtttgttt
tccacaaacaagaaaaaaatcaaggagttccatcagtattttcaagtttatgatgaagat
tttgagtatgggtcccagttgccagagtgtcttctaagaaactggtcaaaatccaaaaag
tggttcctggaactgtttgagaaaaacattccagatataaaagcatgtaaatctgcaaaa
gataattccatgacattattgcaagctacgctggatattgtagagacggaaacaagtaag
gaaaactcacccaattatgggctcttactgctttgggcttctctgtctaatgctgttcct
gttgcattttggacacttgcatacgtcctttctcatcctgatatccacaaggccattatg
gaaggcatatcttctgtgtttggcaaagcaggcaaagataagattaaagtgtctgaggat
gacctggagaatctccttctaattaaatggtgtgttttggaaaccattcgtttaaaagct
cctggtgtcattactagaaaagtggtgaagcctgtggaaattttgaattacatcattcct
tctggtgacttgttgatgttgtctccattttggctgcatagaaatccaaagtattttcct
gagcctgaattgttcaaacctgaacgttggaaaaaggcaaatttagagaagcactctttc
ttggactgcttcatggcatttggaagcgggaagttccagtgtcctgcaaggtggtttgct
ctgttagaggttcagatgtgtattattttaatactttataaatatgactgtagtcttctg
gacccattacccaaacagagttatctccatttggtgggtgtcccccagccggaagggcaa
tgccgaattgaatataaacaaagaatatga

DBGET integrated database retrieval system