KEGG   Homo sapiens (human): 51302Help
Entry
51302             CDS       T01001                                 

Gene name
CYP39A1
Definition
cytochrome P450, family 39, subfamily A, polypeptide 1 (EC:1.14.13.99)
Orthology
K07439  
24-hydroxycholesterol 7alpha-hydroxylase [EC:1.14.13.99]
Organism
hsa  Homo sapiens (human)
Pathway
Primary bile acid biosynthesis
Class
Metabolism; Lipid metabolism; Primary bile acid biosynthesis [PATH:hsa00120]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p21.1-p11.2
AA seq 449 aa AA seqDB search
MELISPTVIIILGCLALFLLLQRKNLRRPPCIKGWIPWIGVGFEFGKAPLEFIEKARIKY
GPIFTVFAMGNRMTFVTEEEGINVFLKSKKVDFELAVQNIVYRTGKMGTVNLHQFTGQLT
EELHEQLENLGTHGTMDLNNLVRHLLYPVTVNMLFNKSLFSTNKKKIKEFHQYFQVYDED
FEYGSQLPECLLRNWSKSKKWFLELFEKNIPDIKACKSAKDNSMTLLQATLDIVETETSK
ENSPNYGLLLLWASLSNAVPVAFWTLAYVLSHPDIHKAIMEGISSVFGKAGKDKIKVSED
DLENLLLIKWCVLETIRLKAPGVITRKVVKPVEILNYIIPSGDLLMLSPFWLHRNPKYFP
EPELFKPERWKKANLEKHSFLDCFMAFGSGKFQCPARWFALLEVQMCIILILYKYDCSLL
DPLPKQSYLHLVGVPQPEGQCRIEYKQRI
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggaactaatttccccaacagtgattataatcctgggttgccttgctctgttcttactc
cttcagcggaagaatttgcgtagacccccgtgcatcaagggctggattccttggattgga
gttggatttgagtttgggaaagcccctctagaatttatagagaaagcaagaatcaagtat
ggaccaatatttacagtctttgctatgggaaaccgaatgacctttgttactgaagaagaa
ggaattaatgtgtttctaaaatccaaaaaagtagattttgaactagcagtgcaaaatatc
gtttatcgtacagggaaaatggggactgtcaatctccatcagtttactgggcaactgact
gaagaattacatgaacaactggagaatttaggcactcatgggacaatggacctgaacaac
ttagtaagacatctcctttatccagtcacagtgaatatgctctttaataaaagtttgttt
tccacaaacaagaaaaaaatcaaggagttccatcagtattttcaagtttatgatgaagat
tttgagtatgggtcccagttgccagagtgtcttctaagaaactggtcaaaatccaaaaag
tggttcctggaactgtttgagaaaaacattccagatataaaagcatgtaaatctgcaaaa
gataattccatgacattattgcaagctacgctggatattgtagagacggaaacaagtaag
gaaaactcacccaattatgggctcttactgctttgggcttctctgtctaatgctgttcct
gttgcattttggacacttgcatacgtcctttctcatcctgatatccacaaggccattatg
gaaggcatatcttctgtgtttggcaaagcaggcaaagataagattaaagtgtctgaggat
gacctggagaatctccttctaattaaatggtgtgttttggaaaccattcgtttaaaagct
cctggtgtcattactagaaaagtggtgaagcctgtggaaattttgaattacatcattcct
tctggtgacttgttgatgttgtctccattttggctgcatagaaatccaaagtattttcct
gagcctgaattgttcaaacctgaacgttggaaaaaggcaaatttagagaagcactctttc
ttggactgcttcatggcatttggaagcgggaagttccagtgtcctgcaaggtggtttgct
ctgttagaggttcagatgtgtattattttaatactttataaatatgactgtagtcttctg
gacccattacccaaacagagttatctccatttggtgggtgtcccccagccggaagggcaa
tgccgaattgaatataaacaaagaatatga

DBGET integrated database retrieval system