KEGG   Homo sapiens (human): 51305Help
Entry
51305             CDS       T01001                                 

Gene name
KCNK9, K2p9.1, KT3.2, TASK-3, TASK3
Definition
(RefSeq) potassium two pore domain channel subfamily K member 9
  KO
K04919  
potassium channel subfamily K member 9
Organism
hsa  Homo sapiens (human)
Pathway
Aldosterone synthesis and secretion
Disease
H00709  
Birk Barel mental retardation syndrome (BBMRS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04925 Aldosterone synthesis and secretion
    51305 (KCNK9)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  K+ channel, KCNK, K2px.x
   51305 (KCNK9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8q24.3
AA seq 374 aa AA seqDB search
MKRQNVRTLSLIVCTFTYLLVGAAVFDALESDHEMREEEKLKAEEIRIKGKYNISSEDYR
QLELVILQSEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPL
TLVMFQSLGERMNTFVRYLLKRIKKCCGMRNTDVSMENMVTVGFFSCMGTLCIGAAAFSQ
CEEWSFFHAYYYCFITLTTIGFGDYVALQTKGALQKKPLYVAFSFMYILVGLTVIGAFLN
LVVLRFLTMNSEDERRDAEERASLAGNRNSMVIHIPEEPRPSRPRYKADVPDLQSVCSCT
CYRSQDYGGRSVAPQNSFSAKLAPHYFHSISYKIEEISPSTLKNSLFPSPISSISPGLHS
FTDHQRLMKRRKSV
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgaagaggcagaacgtgcggactctgtccctcatcgtctgcaccttcacctacctgctg
gtgggcgccgccgtgttcgacgccctcgagtcggaccacgagatgcgcgaggaggagaaa
ctcaaagccgaggagatccggatcaaggggaagtacaacatcagcagcgaggactaccgg
cagctggagctggtgatcctgcagtcggaaccgcaccgcgccggcgtccagtggaaattc
gccggctccttctactttgcgatcacggtcatcaccaccataggttatgggcacgctgca
cctggcaccgatgcgggcaaggccttctgcatgttctacgccgtgctgggcatcccgctg
acactggtcatgttccagagcctgggcgagcgcatgaacaccttcgtgcgctacctgctg
aagcgcattaagaagtgctgtggcatgcgcaacactgacgtgtctatggagaacatggtg
actgtgggcttcttctcctgcatggggacgctgtgcatcggggcggccgccttctcccag
tgtgaggagtggagcttcttccacgcctactactactgcttcatcacgttgactaccatt
gggttcggggactacgtggccctgcagaccaagggtgccctgcagaagaagccgctctac
gtggcctttagctttatgtatatcctggtggggctgacggtcatcggggccttcctcaac
ctggtcgtcctcaggttcttgaccatgaacagtgaggatgagcggcgggatgctgaagag
agggcatccctcgccggaaaccgcaacagcatggtcattcacatccctgaggagccgcgg
cccagccggcccaggtacaaggcggacgtcccggacctgcagtctgtgtgctcctgcacc
tgctaccgctcgcaggactatggcggccgctcggtggcaccgcagaactccttcagcgcc
aagcttgccccccactacttccactccatctcttacaagatcgaggagatctcaccaagc
acattaaaaaacagcctcttcccatcgcctattagctccatctctcctgggttacacagc
tttaccgaccaccagaggctgatgaaacgccggaagtccgtttag

DBGET integrated database retrieval system