KEGG   Homo sapiens (human): 51311Help
Entry
51311             CDS       T01001                                 

Gene name
TLR8, CD288
Definition
toll-like receptor 8
Orthology
K10170  
toll-like receptor 8
Organism
hsa  Homo sapiens (human)
Pathway
Toll-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    51311 (TLR8)
Cellular antigens [BR:hsa04090]
 Proteins
  51311 (TLR8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xp22
AA seq 1041 aa AA seqDB search
MENMFLQSSMLTCIFLLISGSCELCAEENFSRSYPCDEKKQNDSVIAECSNRRLQEVPQT
VGKYVTELDLSDNFITHITNESFQGLQNLTKINLNHNPNVQHQNGNPGIQSNGLNITDGA
FLNLKNLRELLLEDNQLPQIPSGLPESLTELSLIQNNIYNITKEGISRLINLKNLYLAWN
CYFNKVCEKTNIEDGVFETLTNLELLSLSFNSLSHVPPKLPSSLRKLFLSNTQIKYISEE
DFKGLINLTLLDLSGNCPRCFNAPFPCVPCDGGASINIDRFAFQNLTQLRYLNLSSTSLR
KINAAWFKNMPHLKVLDLEFNYLVGEIASGAFLTMLPRLEILDLSFNYIKGSYPQHINIS
RNFSKLLSLRALHLRGYVFQELREDDFQPLMQLPNLSTINLGINFIKQIDFKLFQNFSNL
EIIYLSENRISPLVKDTRQSYANSSSFQRHIRKRRSTDFEFDPHSNFYHFTRPLIKPQCA
AYGKALDLSLNSIFFIGPNQFENLPDIACLNLSANSNAQVLSGTEFSAIPHVKYLDLTNN
RLDFDNASALTELSDLEVLDLSYNSHYFRIAGVTHHLEFIQNFTNLKVLNLSHNNIYTLT
DKYNLESKSLVELVFSGNRLDILWNDDDNRYISIFKGLKNLTRLDLSLNRLKHIPNEAFL
NLPASLTELHINDNMLKFFNWTLLQQFPRLELLDLRGNKLLFLTDSLSDFTSSLRTLLLS
HNRISHLPSGFLSEVSSLKHLDLSSNLLKTINKSALETKTTTKLSMLELHGNPFECTCDI
GDFRRWMDEHLNVKIPRLVDVICASPGDQRGKSIVSLELTTCVSDVTAVILFFFTFFITT
MVMLAALAHHLFYWDVWFIYNVCLAKVKGYRSLSTSQTFYDAYISYDTKDASVTDWVINE
LRYHLEESRDKNVLLCLEERDWDPGLAIIDNLMQSINQSKKTVFVLTKKYAKSWNFKTAF
YLALQRLMDENMDVIIFILLEPVLQHSQYLRLRQRICKSSILQWPDNPKAEGLFWQTLRN
VVLTENDSRYNNMYVDSIKQY
NT seq 3126 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacatgttccttcagtcgtcaatgctgacctgcattttcctgctaatatctggt
tcctgtgagttatgcgccgaagaaaatttttctagaagctatccttgtgatgagaaaaag
caaaatgactcagttattgcagagtgcagcaatcgtcgactacaggaagttccccaaacg
gtgggcaaatatgtgacagaactagacctgtctgataatttcatcacacacataacgaat
gaatcatttcaagggctgcaaaatctcactaaaataaatctaaaccacaaccccaatgta
cagcaccagaacggaaatcccggtatacaatcaaatggcttgaatatcacagacggggca
ttcctcaacctaaaaaacctaagggagttactgcttgaagacaaccagttaccccaaata
ccctctggtttgccagagtctttgacagaacttagtctaattcaaaacaatatatacaac
ataactaaagagggcatttcaagacttataaacttgaaaaatctctatttggcctggaac
tgctattttaacaaagtttgcgagaaaactaacatagaagatggagtatttgaaacgctg
acaaatttggagttgctatcactatctttcaattctctttcacacgtgccacccaaactg
ccaagctccctacgcaaactttttctgagcaacacccagatcaaatacattagtgaagaa
gatttcaagggattgataaatttaacattactagatttaagcgggaactgtccgaggtgc
ttcaatgccccatttccatgcgtgccttgtgatggtggtgcttcaattaatatagatcgt
tttgcttttcaaaacttgacccaacttcgatacctaaacctctctagcacttccctcagg
aagattaatgctgcctggtttaaaaatatgcctcatctgaaggtgctggatcttgaattc
aactatttagtgggagaaatagcctctggggcatttttaacgatgctgccccgcttagaa
atacttgacttgtcttttaactatataaaggggagttatccacagcatattaatatttcc
agaaacttctctaaacttttgtctctacgggcattgcatttaagaggttatgtgttccag
gaactcagagaagatgatttccagcccctgatgcagcttccaaacttatcgactatcaac
ttgggtattaattttattaagcaaatcgatttcaaacttttccaaaatttctccaatctg
gaaattatttacttgtcagaaaacagaatatcaccgttggtaaaagatacccggcagagt
tatgcaaatagttcctcttttcaacgtcatatccggaaacgacgctcaacagattttgag
tttgacccacattcgaacttttatcatttcacccgtcctttaataaagccacaatgtgct
gcttatggaaaagccttagatttaagcctcaacagtattttcttcattgggccaaaccaa
tttgaaaatcttcctgacattgcctgtttaaatctgtctgcaaatagcaatgctcaagtg
ttaagtggaactgaattttcagccattcctcatgtcaaatatttggatttgacaaacaat
agactagactttgataatgctagtgctcttactgaattgtccgacttggaagttctagat
ctcagctataattcacactatttcagaatagcaggcgtaacacatcatctagaatttatt
caaaatttcacaaatctaaaagttttaaacttgagccacaacaacatttatactttaaca
gataagtataacctggaaagcaagtccctggtagaattagttttcagtggcaatcgcctt
gacattttgtggaatgatgatgacaacaggtatatctccattttcaaaggtctcaagaat
ctgacacgtctggatttatcccttaataggctgaagcacatcccaaatgaagcattcctt
aatttgccagcgagtctcactgaactacatataaatgataatatgttaaagttttttaac
tggacattactccagcagtttcctcgtctcgagttgcttgacttacgtggaaacaaacta
ctctttttaactgatagcctatctgactttacatcttcccttcggacactgctgctgagt
cataacaggatttcccacctaccctctggctttctttctgaagtcagtagtctgaagcac
ctcgatttaagttccaatctgctaaaaacaatcaacaaatccgcacttgaaactaagacc
accaccaaattatctatgttggaactacacggaaacccctttgaatgcacctgtgacatt
ggagatttccgaagatggatggatgaacatctgaatgtcaaaattcccagactggtagat
gtcatttgtgccagtcctggggatcaaagagggaagagtattgtgagtctggagctaaca
acttgtgtttcagatgtcactgcagtgatattatttttcttcacgttctttatcaccacc
atggttatgttggctgccctggctcaccatttgttttactgggatgtttggtttatatat
aatgtgtgtttagctaaggtaaaaggctacaggtctctttccacatcccaaactttctat
gatgcttacatttcttatgacaccaaagatgcctctgttactgactgggtgataaatgag
ctgcgctaccaccttgaagagagccgagacaaaaacgttctcctttgtctagaggagagg
gattgggacccgggattggccatcatcgacaacctcatgcagagcatcaaccaaagcaag
aaaacagtatttgttttaaccaaaaaatatgcaaaaagctggaactttaaaacagctttt
tacttggctttgcagaggctaatggatgagaacatggatgtgattatatttatcctgctg
gagccagtgttacagcattctcagtatttgaggctacggcagcggatctgtaagagctcc
atcctccagtggcctgacaacccgaaggcagaaggcttgttttggcaaactctgagaaat
gtggtcttgactgaaaatgattcacggtataacaatatgtatgtcgattccattaagcaa
tactaa

DBGET integrated database retrieval system