KEGG   Homo sapiens (human): 51314Help
Entry
51314             CDS       T01001                                 

Gene name
NME8, CILD6, NM23-H8, SPTRX2, TXNDC3, sptrx-2
Definition
NME/NM23 family member 8
Organism
hsa  Homo sapiens (human)
Disease
H00564  
Primary ciliary dyskinesia
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7p14.1
AA seq 588 aa AA seqDB search
MASKKREVQLQTVINNQSLWDEMLQNKGLTVIDVYQAWCGPCRAMQPLFRKLKNELNEDE
ILHFAVAEADNIVTLQPFRDKCEPVFLFSVNGKIIEKIQGANAPLVNKKVINLIDEERKI
AAGEMARPQYPEIPLVDSDSEVSEESPCESVQELYSIAIIKPDAVISKKVLEIKRKITKA
GFIIEAEHKTVLTEEQVVNFYSRIADQCDFEEFVSFMTSGLSYILVVSQGSKHNPPSEET
EPQTDTEPNERSEDQPEVEAQVTPGMMKNKQDSLQEYLERQHLAQLCDIEEDAANVAKFM
DAFFPDFKKMKSMKLEKTLALLRPNLFHERKDDVLRIIKDEDFKILEQRQVVLSEKEAQA
LCKEYENEDYFNKLIENMTSGPSLALVLLRDNGLQYWKQLLGPRTVEEAIEYFPESLCAQ
FAMDSLPVNQLYGSDSLETAEREIQHFFPLQSTLGLIKPHATSEQREQILKIVKEAGFDL
TQVKKMFLTPEQIEKIYPKVTGKDFYKDLLEMLSVGPSMVMILTKWNAVAEWRRLMGPTD
PEEAKLLSPDSIRAQFGISKLKNIVHGASNAYEAKEVVNRLFEDPEEN
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcaaaaaacgagaagtccagttacagacagtcatcaataatcaaagcctgtgg
gatgagatgttgcagaacaaaggcttaacagtgattgatgtttaccaagcctggtgtgga
ccttgcagagcaatgcaacctttattcagaaaattgaaaaatgaactgaacgaagacgaa
attctgcattttgctgtcgcagaagctgacaacattgtgactttgcagccatttagagat
aaatgtgaacctgtttttctctttagtgttaatggcaaaattatcgaaaagattcagggt
gcaaatgcaccgcttgttaataaaaaagttattaatttgatcgatgaggagagaaaaatt
gcagcaggtgaaatggctcgacctcagtatcctgaaattccattagtagactcagattca
gaagttagtgaagaatcaccatgtgaaagtgttcaggaattatacagtattgctattatc
aaaccggatgctgtgattagtaaaaaagttctagaaattaaaagaaaaattaccaaagct
ggatttattatagaagcagagcataagacagtgctcactgaagaacaagttgtcaacttc
tatagtcgaatagcagaccagtgtgacttcgaagagtttgtctcttttatgacaagtggc
ttaagctatattctagttgtatctcaaggaagtaaacacaatcctccctctgaagaaacc
gaaccacagactgacaccgaacctaacgaacgatctgaggatcaacctgaggtcgaagcc
caggttacacctggaatgatgaagaacaaacaagacagtttacaagaatatctggaaaga
caacatttagctcagctctgtgacattgaagaggatgcagctaatgttgctaagttcatg
gatgctttcttccccgattttaaaaaaatgaaaagcatgaaattagaaaagacattggca
ttacttcgaccaaatctctttcatgaaaggaaagatgatgttttgcgtattattaaagat
gaagacttcaaaatactggagcaaagacaagtagtattatcggaaaaagaagcacaagca
ctgtgcaaggaatatgaaaatgaagactattttaataaacttatagaaaacatgaccagt
ggtccatctctagcccttgttttattgagagacaatggcttgcaatactggaaacaatta
ctgggaccaagaactgttgaagaagccattgaatattttccagagagtttatgtgcacag
tttgcgatggacagtttgccggtcaaccagttgtatggcagcgattcattagaaaccgct
gaaagggaaatacagcatttctttcctcttcaaagcactttaggcttgattaaacctcat
gcaacaagtgaacaaagagagcagatcctgaagatagttaaggaggctggatttgatctg
acacaggtgaagaaaatgttcctaactcctgagcaaatagagaaaatttatccaaaagta
acaggaaaagacttttataaagatttattggaaatgttatctgtgggtccatctatggtc
atgattctgaccaagtggaatgctgttgcagaatggagacgattgatgggcccaacagac
ccagaagaagcaaaattactttcccctgactccatccgagcccagtttggaataagtaaa
ttgaaaaacattgtccatggagcatctaacgcctatgaagcaaaagaggttgttaataga
ctctttgaggatcctgaggaaaactaa

DBGET integrated database retrieval system