KEGG   Homo sapiens (human): 5132Help
Entry
5132              CDS       T01001                                 

Gene name
PDC, MEKA, PHD, PhLOP, PhLP
Definition
(RefSeq) phosducin
  KO
K08327  phosducin
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Phosducin Thioredoxin
Motif
Other DBs
NCBI-GeneID: 5132
NCBI-ProteinID: NP_002588
OMIM: 171490
HGNC: 8759
Ensembl: ENSG00000116703
Vega: OTTHUMG00000035575
Pharos: P20941(Tbio)
UniProt: P20941 Q52LP8
Position
1q31.1
AA seq 246 aa AA seqDB search
MEEAKSQSLEEDFEGQATHTGPKGVINDWRKFKLESQDSDSIPPSKKEILRQMSSPQSRN
GKDSKERVSRKMSIQEYELIHKEKEDENCLRKYRRQCMQDMHQKLSFGPRYGFVYELETG
KQFLETIEKELKITTIVVHIYEDGIKGCDALNSSLTCLAAEYPIVKFCKIKASNTGAGDR
FSLDVLPTLLIYKGGELISNFISVAEQFAEEFFAGDVESFLNEYGLLPEREVHVLEHTKI
EEEDVE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagccaaaagccaaagtttggaggaagactttgaaggacaggccacacataca
ggacccaaaggagtaataaatgattggagaaagtttaaattagagagtcaagacagtgat
tcaattccacctagcaagaaggagattctcaggcaaatgtcttctcctcagagtaggaat
ggcaaagattcaaaggaacgagtcagcagaaagatgagcattcaagaatatgaactaatc
cataaagagaaagaggatgaaaactgccttcgtaaataccgtagacagtgtatgcaggat
atgcaccagaagctgagttttgggcctagatatgggtttgtgtatgagctggaaactgga
aagcaattcctagaaacaattgaaaaggaactgaagatcaccacaattgttgttcacatt
tatgaagatggtattaagggttgtgatgctctaaacagtagtttaacatgccttgcagca
gaataccctatagttaagttttgtaaaataaaagcttcgaatacaggtgctggggaccgc
ttttccttagatgtacttcctacactgctcatctataaaggtggggaactcataagcaat
tttattagtgttgctgaacagtttgctgaagaattttttgctggggatgtggagtctttc
ctaaatgaatatgggttactacctgaaagagaggtacatgtcctagagcataccaaaata
gaagaagaagatgttgaatga

DBGET integrated database retrieval system