KEGG   Homo sapiens (human): 5132Help
Entry
5132              CDS       T01001                                 

Gene name
PDC, MEKA, PHD, PhLOP, PhLP
Definition
phosducin
Orthology
K08327  
phosducin
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    5132 (PDC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q25.2
AA seq 246 aa AA seqDB search
MEEAKSQSLEEDFEGQATHTGPKGVINDWRKFKLESQDSDSIPPSKKEILRQMSSPQSRN
GKDSKERVSRKMSIQEYELIHKEKEDENCLRKYRRQCMQDMHQKLSFGPRYGFVYELETG
KQFLETIEKELKITTIVVHIYEDGIKGCDALNSSLTCLAAEYPIVKFCKIKASNTGAGDR
FSLDVLPTLLIYKGGELISNFISVAEQFAEEFFAGDVESFLNEYGLLPEREVHVLEHTKI
EEEDVE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagccaaaagccaaagtttggaggaagactttgaaggacaggccacacataca
ggacccaaaggagtaataaatgattggagaaagtttaaattagagagtcaagacagtgat
tcaattccacctagcaagaaggagattctcaggcaaatgtcttctcctcagagtaggaat
ggcaaagattcaaaggaacgagtcagcagaaagatgagcattcaagaatatgaactaatc
cataaagagaaagaggatgaaaactgccttcgtaaataccgtagacagtgtatgcaggat
atgcaccagaagctgagttttgggcctagatatgggtttgtgtatgagctggaaactgga
aagcaattcctagaaacaattgaaaaggaactgaagatcaccacaattgttgttcacatt
tatgaagatggtattaagggttgtgatgctctaaacagtagtttaacatgccttgcagca
gaataccctatagttaagttttgtaaaataaaagcttcgaatacaggtgctggggaccgc
ttttccttagatgtacttcctacactgctcatctataaaggtggggaactcataagcaat
tttattagtgttgctgaacagtttgctgaagaattttttgctggggatgtggagtctttc
ctaaatgaatatgggttactacctgaaagagaggtacatgtcctagagcataccaaaata
gaagaagaagatgttgaatga

DBGET integrated database retrieval system