KEGG   Homo sapiens (human): 5133Help
Entry
5133              CDS       T01001                                 

Gene name
PDCD1, CD279, PD-1, PD1, SLEB2, hPD-1, hPD-l, hSLE1
Definition
(RefSeq) programmed cell death 1
  KO
K06744  
programmed cell death protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
T cell receptor signaling pathway
Disease
H00080  
Systemic lupus erythematosus
H01490  
Multiple sclerosis
Drug target
Nivolumab: 
Pembrolizumab: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    5133 (PDCD1)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    5133 (PDCD1)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Immune system
   B7-CD28 family
    PDCD1LG1, CD274; programmed cell death 1 ligand 1 [KO:K06745]
     5133 (PDCD1)
    PDCD1LG2, CD273; programmed cell death 1 ligand 2 [KO:K06708]
     5133 (PDCD1)
Cellular antigens [BR:hsa04090]
 Proteins
  5133 (PDCD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q37.3
AA seq 288 aa AA seqDB search
MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTS
ESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGT
YLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQTLVVGVVGGLLGS
LVLLVWVLAVICSRAARGTIGARRTGQPLKEDPSAVPVFSVDYGELDFQWREKTPEPPVP
CVPEQTEYATIVFPSGMGTSSPARRGSADGPRSAQPLRPEDGHCSWPL
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcccacaggcgccctggccagtcgtctgggcggtgctacaactgggctggcgg
ccaggatggttcttagactccccagacaggccctggaacccccccaccttctccccagcc
ctgctcgtggtgaccgaaggggacaacgccaccttcacctgcagcttctccaacacatcg
gagagcttcgtgctaaactggtaccgcatgagccccagcaaccagacggacaagctggcc
gccttccccgaggaccgcagccagcccggccaggactgccgcttccgtgtcacacaactg
cccaacgggcgtgacttccacatgagcgtggtcagggcccggcgcaatgacagcggcacc
tacctctgtggggccatctccctggcccccaaggcgcagatcaaagagagcctgcgggca
gagctcagggtgacagagagaagggcagaagtgcccacagcccaccccagcccctcaccc
aggccagccggccagttccaaaccctggtggttggtgtcgtgggcggcctgctgggcagc
ctggtgctgctagtctgggtcctggccgtcatctgctcccgggccgcacgagggacaata
ggagccaggcgcaccggccagcccctgaaggaggacccctcagccgtgcctgtgttctct
gtggactatggggagctggatttccagtggcgagagaagaccccggagccccccgtgccc
tgtgtccctgagcagacggagtatgccaccattgtctttcctagcggaatgggcacctca
tcccccgcccgcaggggctcagctgacggccctcggagtgcccagccactgaggcctgag
gatggacactgctcttggcccctctga

DBGET integrated database retrieval system