KEGG   Homo sapiens (human): 51330Help
Entry
51330             CDS       T01001                                 

Gene name
TNFRSF12A, CD266, FN14, TWEAKR
Definition
tumor necrosis factor receptor superfamily, member 12A
Orthology
K05149  
tumor necrosis factor receptor superfamily member 12A
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    51330 (TNFRSF12A)
Cellular antigens [BR:hsa04090]
 Proteins
  51330 (TNFRSF12A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16p13.3
AA seq 129 aa AA seqDB search
MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPH
SDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGE
GCPAVALIQ
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atggctcggggctcgctgcgccggttgctgcggctcctcgtgctggggctctggctggcg
ttgctgcgctccgtggccggggagcaagcgccaggcaccgccccctgctcccgcggcagc
tcctggagcgcggacctggacaagtgcatggactgcgcgtcttgcagggcgcgaccgcac
agcgacttctgcctgggctgcgctgcagcacctcctgcccccttccggctgctttggccc
atccttgggggcgctctgagcctgaccttcgtgctggggctgctttctggctttttggtc
tggagacgatgccgcaggagagagaagttcaccacccccatagaggagaccggcggagag
ggctgcccagctgtggcgctgatccagtga

DBGET integrated database retrieval system