KEGG   Homo sapiens (human): 51340Help
Entry
51340             CDS       T01001                                 

Gene name
CRNKL1, CLF, CRN, Clf1, HCRN, MSTP021, SYF3
Definition
crooked neck pre-mRNA splicing factor 1
Orthology
K12869  
crooked neck
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Module
Spliceosome, 35S U5-snRNP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    51340 (CRNKL1)
Spliceosome [BR:hsa03041]
 Complex B
  Other components
   Prp19-related factors
    51340 (CRNKL1)
 Complex C
    51340 (CRNKL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
20p11.2
AA seq 836 aa AA seqDB search
MTATVENLTFQKDTLGNAVDKNRRHGSTEPLVLAWSSQFRRLTWGCALDALHRSPCVAAS
QHGVTHLIRSSRTPHSTRCRKEDAQPGHHGNGAASVTAQARGQRSVLQVPLPVPRSCLFS
ESFVVSVSSQSRFLASVPGTGVQRSTAADMAASTAAGKQRIPKVAKVKNKAPAEVQITAE
QLLREAKERELELLPPPPQQKITDEEELNDYKLRKRKTFEDNIRKNRTVISNWIKYAQWE
ESLKEIQRARSIYERALDVDYRNITLWLKYAEMEMKNRQVNHARNIWDRAITTLPRVNQF
WYKYTYMEEMLGNVAGARQVFERWMEWQPEEQAWHSYINFELRYKEVDRARTIYERFVLV
HPDVKNWIKYARFEEKHAYFAHARKVYERAVEFFGDEHMDEHLYVAFAKFEENQKEFERV
RVIYKYALDRISKQDAQELFKNYTIFEKKFGDRRGIEDIIVSKRRFQYEEEVKANPHNYD
AWFDYLRLVESDAEAEAVREVYERAIANVPPIQEKRHWKRYIYLWINYALYEELEAKDPE
RTRQVYQASLELIPHKKFTFAKMWILYAQFEIRQKNLSLARRALGTSIGKCPKNKLFKVY
IELELQLREFDRCRKLYEKFLEFGPENCTSWIKFAELETILGDIDRARAIYELAISQPRL
DMPEVLWKSYIDFEIEQEETERTRNLYRRLLQRTQHVKVWISFAQFELSSGKEGSLTKCR
QIYEEANKTMRNCEEKEERLMLLESWRSFEEEFGTASDKERVDKLMPEKVKKRRKVQTDD
GSDAGWEEYFDYIFPEDAANQPNLKLLAMAKLWKKQQQEKEDAEHHPDEDVDESES
NT seq 2511 nt NT seq  +upstreamnt  +downstreamnt
atgacggcaacagtggagaacctaacgttccagaaggacactttgggaaatgctgttgac
aaaaacaggcgccacggctcgacagagccactcgtcctcgcctggtcatcccagttccgg
aggctgacctggggatgcgccctggacgccctgcaccgcagtccttgcgtcgctgctagt
cagcacggcgttacccacctcatccgcagctccaggacgccgcactccacgcgctgccgc
aaggaggacgcgcagcctggtcaccatggaaacggtgccgcctccgtcacggctcaagcg
agaggtcaaaggtcagtcctgcaagttccgcttccggttccgagatcctgtttgttttct
gaaagctttgtggtttcggtgagctctcagagccgatttctagcgtccgtgccggggaca
ggtgtccagaggtcgactgctgcagacatggcggcctccaccgcggccgggaagcagcgg
attcccaaagtggccaaggtgaaaaacaaagccccggctgaggtacagataactgctgaa
caactcttaagagaggctaaagaaagagaacttgagcttcttccacctccacctcaacag
aagatcacagatgaagaagaattaaatgattataaactaaggaaaaggaagacttttgaa
gataatataagaaaaaacaggactgtgattagtaactggataaaatacgcacaatgggaa
gaaagcctaaaggagattcaaagggctcgatccatatacgagcgtgctttagatgtagac
taccgaaatattacactctggctgaaatacgcagaaatggaaatgaagaatcgccaagtc
aaccatgctcgaaatatctgggaccgggccataacaacgctgcctcgagttaatcagttc
tggtacaagtacacgtacatggaggaaatgttgggaaacgttgccggtgcccggcaggtg
tttgagcgctggatggagtggcagcctgaggagcaagcctggcactcctacatcaacttt
gagctgagatacaaagaggtggatcgggcccgcaccatttatgagcgatttgtcctcgtg
caccctgatgttaagaactggatcaagtatgcccgctttgaagaaaaacatgcttatttt
gcccatgcacggaaagtgtatgagagagctgtggaattctttggagatgaacatatggat
gagcacctttatgttgcctttgccaagtttgaagaaaatcagaaagagtttgaaagggta
cgagtgatttacaagtatgccctggacagaatttcaaaacaagatgcccaagaactcttt
aaaaattataccatctttgagaagaagtttggtgataggcggggtattgaagatatcatt
gtgagcaaacggagattccagtacgaagaagaagtgaaggcgaatccacacaattatgat
gcatggtttgattacttgcgcttggtagaaagtgacgcagaagctgaagccgtgagagaa
gtctatgaaagggccattgccaatgtcccacccattcaggagaagaggcactggaagcgc
tacatttatctttggatcaactatgcactctatgaagaattggaggcaaaggatcctgag
aggacaagacaggtgtatcaagcctctttggaactaattcctcacaaaaagttcacattt
gccaaaatgtggatactgtatgcacagtttgaaatacgacagaagaatctgtcattagcc
agaagagcattgggaacttccataggcaaatgtccaaagaacaaattatttaaagtttac
atagaattggagctacagcttcgagaatttgacagatgccggaagctttatgaaaagttc
ctggaatttggacctgaaaattgtacctcatggattaaattcgctgaattagagacaatc
cttggtgatattgacagagcacgggcaatctatgaattagccatcagtcagccacgttta
gacatgccagaggtgctttggaaatcatatattgattttgaaattgagcaggaagaaaca
gaaagaacacgaaacctttaccggcggttgcttcaacggacgcagcatgtcaaggtatgg
atcagctttgctcagtttgagttgtcttcaggaaaagaaggaagtttgactaaatgcaga
caaatttatgaagaagctaacaaaaccatgcgaaactgtgaagaaaaggaagagagactt
atgctgctggaatcttggcgaagttttgaagaagaatttggaacagcttcagataaggag
agagtagacaaactcatgccagagaaagtcaagaagagaagaaaggtccagactgatgat
gggtctgatgcaggctgggaagaatactttgattacatctttccagaagatgctgccaac
caacctaacctcaaactcctggccatggccaaactgtggaagaaacagcagcaggaaaag
gaggatgctgagcaccatccagatgaggacgtcgatgagagtgaatcctga

DBGET integrated database retrieval system