KEGG   Homo sapiens (human): 51343Help
Entry
51343             CDS       T01001                                 

Gene name
FZR1, CDC20C, CDH1, FZR, FZR2, HCDH, HCDH1
Definition
(RefSeq) fizzy/cell division cycle 20 related 1
  KO
K03364  
cell division cycle 20-like protein 1, cofactor of APC complex
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    51343 (FZR1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    51343 (FZR1)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    51343 (FZR1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Target recognizing subunit
     51343 (FZR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.3
AA seq 496 aa AA seqDB search
MDQDYERRLLRQIVIQNENTMPRVTEMRRTLTPASSPVSSPSKHGDRFIPSRAGANWSVN
FHRINENEKSPSQNRKAKDATSDNGKDGLAYSALLKNELLGAGIEKVQDPQTEDRRLQPS
TPEKKGLFTYSLSTKRSSPDDGNDVSPYSLSPVSNKSQKLLRSPRKPTRKISKIPFKVLD
APELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLSVEGDSVTSVGWSER
GNLVAVGTHKGFVQIWDAAAGKKLSMLEGHTARVGALAWNAEQLSSGSRDRMILQRDIRT
PPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSSLSPVQQYTEHLAAVKA
IAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGY
SQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTK
VKWESVSVLNLFTRIR
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggaccaggactatgagcggcgcctgcttcgccagatcgtcatccagaatgagaacacg
atgccacgcgtcacagagatgcggcggaccctgacgcctgccagctccccagtgtcctcg
cccagcaagcacggagaccgcttcatcccctccagagccggagccaactggagcgtgaac
ttccacaggattaacgagaatgagaagtctcccagtcagaaccggaaagccaaggacgcc
acctcagacaacggcaaagacggcctggcctactctgccctgctcaagaatgagctgctg
ggtgccggcatcgagaaggtgcaggacccgcagactgaggaccgcaggctgcagccctcc
acgcctgagaagaagggtctgttcacgtattcccttagcaccaagcgctccagccccgat
gacggcaacgatgtgtctccctactccctgtctcccgtcagcaacaagagccagaagctg
ctccggtccccccggaaacccacccgcaagatctccaagatccccttcaaggtgctggac
gcgcccgagctgcaggacgacttctacctcaatctggtggactggtcgtccctcaatgtg
ctcagcgtggggctaggcacctgcgtgtacctgtggagtgcctgtaccagccaggtgacg
cggctctgtgacctctcagtggaaggggactcagtgacctccgtgggctggtctgagcgg
gggaacctggtggcggtgggcacacacaagggcttcgtgcagatctgggacgcagccgca
gggaagaagctgtccatgttggagggccacacggcacgcgtcggggcgctggcctggaat
gctgagcagctgtcgtccgggagccgcgaccgcatgatcctgcagagggacatccgcacc
ccgccactgcagtcggagcggcggctgcagggccaccggcaggaggtgtgcgggctcaag
tggtccacagaccaccagctcctcgcctcggggggcaacgacaacaagctgctggtctgg
aatcactcgagcctgagccccgtgcagcagtacacggagcacctggcggccgtgaaggcc
atcgcctggtccccacatcagcacgggctgctggcctcggggggcggcacagctgaccgc
tgtatccgcttctggaacacgctgacaggacaaccactgcagtgtatcgacacgggctcc
caagtgtgcaatctggcctggtccaagcacgccaacgagctggtgagcacgcacggctac
tcacagaaccagatccttgtctggaagtacccctccctgacccaggtggccaagctgacc
gggcactcctaccgcgtgctgtacctggcaatgtcccctgatggggaggccatcgtcact
ggtgctggagacgagaccctgaggttctggaacgtctttagcaaaacccgttcgacaaag
gtaaagtgggagtctgtgtctgtgctcaacctcttcaccaggatccggtaa

DBGET integrated database retrieval system