KEGG   Homo sapiens (human): 51343Help
Entry
51343             CDS       T01001                                 

Gene name
FZR1, CDC20C, CDH1, FZR, FZR2, HCDH, HCDH1
Definition
fizzy/cell division cycle 20 related 1 (Drosophila)
Orthology
K03364  
cell division cycle 20-like protein 1, cofactor of APC complex
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
Module
APC/C complex
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:hsa04120]
Cellular Processes; Cell growth and death; Cell cycle [PATH:hsa04110]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:hsa04914]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
19p13.3
AA seq 404 aa AA seqDB search
MDQDYERRLLRQIVIQNENTMPRVTEMRRTLTPASSPVSSPSKHGDRFIPSRAGANWSVN
FHRINENEKSPSQNRKAKDATSDNGKDGLAYSALLKNELLGAGIEKVQDPQTEDRRLQPS
TPEKKGLFTVTRLCDLSVEGDSVTSVGWSERGNLVAVGTHKGFVQIWDAAAGKKLSMLEG
HTARVGALAWNAEQLSSGSRDRMILQRDIRTPPLQSERRLQGHRQEVCGLKWSTDHQLLA
SGGNDNKLLVWNHSSLSPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLT
GQPLQCIDTGSQVCNLAWSKHANELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYL
AMSPDGEAIVTGAGDETLRFWNVFSKTRSTKESVSVLNLFTRIR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggaccaggactatgagcggcgcctgcttcgccagatcgtcatccagaatgagaacacg
atgccacgcgtcacagagatgcggcggaccctgacgcctgccagctccccagtgtcctcg
cccagcaagcacggagaccgcttcatcccctccagagccggagccaactggagcgtgaac
ttccacaggattaacgagaatgagaagtctcccagtcagaaccggaaagccaaggacgcc
acctcagacaacggcaaagacggcctggcctactctgccctgctcaagaatgagctgctg
ggtgccggcatcgagaaggtgcaggacccgcagactgaggaccgcaggctgcagccctcc
acgcctgagaagaagggtctgttcacggtgacgcggctctgtgacctctcagtggaaggg
gactcagtgacctccgtgggctggtctgagcgggggaacctggtggcggtgggcacacac
aagggcttcgtgcagatctgggacgcagccgcagggaagaagctgtccatgttggagggc
cacacggcacgcgtcggggcgctggcctggaatgctgagcagctgtcgtccgggagccgc
gaccgcatgatcctgcagagggacatccgcaccccgccactgcagtcggagcggcggctg
cagggccaccggcaggaggtgtgcgggctcaagtggtccacagaccaccagctcctcgcc
tcggggggcaacgacaacaagctgctggtctggaatcactcgagcctgagccccgtgcag
cagtacacggagcacctggcggccgtgaaggccatcgcctggtccccacatcagcacggg
ctgctggcctcggggggcggcacagctgaccgctgtatccgcttctggaacacgctgaca
ggacaaccactgcagtgtatcgacacgggctcccaagtgtgcaatctggcctggtccaag
cacgccaacgagctggtgagcacgcacggctactcacagaaccagatccttgtctggaag
tacccctccctgacccaggtggccaagctgaccgggcactcctaccgcgtgctgtacctg
gcaatgtcccctgatggggaggccatcgtcactggtgctggagacgagaccctgaggttc
tggaacgtctttagcaaaacccgttcgacaaaggagtctgtgtctgtgctcaacctcttc
accaggatccggtaa

DBGET integrated database retrieval system