KEGG   Homo sapiens (human): 51366Help
Entry
51366             CDS       T01001                                 

Gene name
UBR5, DD5, EDD, EDD1, HYD
Definition
ubiquitin protein ligase E3 component n-recognin 5
Orthology
K10593  
E3 ubiquitin-protein ligase EDD1 [EC:6.3.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:hsa04120]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8q22
AA seq 2799 aa AA seqDB search
MTSIHFVVHPLPGTEDQLNDRLREVSEKLNKYNLNSHPPLNVLEQATIKQCVVGPNHAAF
LLEDGRVCRIGFSVQPDRLELGKPDNNDGSKLNSNSGAGRTSRPGRTSDSPWFLSGSETL
GRLAGNTLGSRWSSGVGGSGGGSSGRSSAGARDSRRQTRVIRTGRDRGSGLLGSQPQPVI
PASVIPEELISQAQVVLQGKSRSVIIRELQRTNLDVNLAVNNLLSRDDEDGDDGDDTASE
SYLPGEDLMSLLDADIHSAHPSVIIDADAMFSEDISYFGYPSFRRSSLSRLGSSRVLLLP
LERDSELLRERESVLRLRERRWLDGASFDNERGSTSKEGEPNLDKKNTPVQSPVSLGEDL
QWWPDKDGTKFICIGALYSELLAVSSKGELYQWKWSESEPYRNAQNPSLHHPRATFLGLT
NEKIVLLSANSIRATVATENNKVATWVDETLSSVASKLEHTAQTYSELQGERIVSLHCCA
LYTCAQLENSLYWWGVVPFSQRKKMLEKARAKNKKPKSSAGISSMPNITVGTQVCLRNNP
LYHAGAVAFSISAGIPKVGVLMESVWNMNDSCRFQLRSPESLKNMEKASKTTEAKPESKQ
EPVKTEMGPPPSPASTCSDASSIASSASMPYKRRRSTPAPKEEEKVNEEQWSLREVVFVE
DVKNVPVGKVLKVDGAYVAVKFPGTSSNTNCQNSSGPDADPSSLLQDCRLLRIDELQVVK
TGGTPKVPDCFQRTPKKLCIPEKTEILAVNVDSKGVHAVLKTGNWVRYCIFDLATGKAEQ
ENNFPTSSIAFLGQNERNVAIFTAGQESPIILRDGNGTIYPMAKDCMGGIRDPDWLDLPP
ISSLGMGVHSLINLPANSTIKKKAAVIIMAVEKQTLMQHILRCDYEACRQYLMNLEQAVV
LEQNLQMLQTFISHRCDGNRNILHACVSVCFPTSNKETKEEEEAERSERNTFAERLSAVE
AIANAISVVSSNGPGNRAGSSSSRSLRLREMMRRSLRAAGLGRHEAGASSSDHQDPVSPP
IAPPSWVPDPPAMDPDGDIDFILAPAVGSLTTAATGTGQGPSTSTIPGPSTEPSVVESKD
RKANAHFILKLLCDSVVLQPYLRELLSAKDARGMTPFMSAVSGRAYPAAITILETAQKIA
KAEISSSEKEEDVFMGMVCPSGTNPDDSPLYVLCCNDTCSFTWTGAEHINQDIFECRTCG
LLESLCCCTECARVCHKGHDCKLKRTSPTAYCDCWEKCKCKTLIAGQKSARLDLLYRLLT
ATNLVTLPNSRGEHLLLFLVQTVARQTVEHCQYRPPRIREDRNRKTASPEDSDMPDHDLE
PPRFAQLALERVLQDWNALKSMIMFGSQENKDPLSASSRIGHLLPEEQVYLNQQSGTIRL
DCFTHCLIVKCTADILLLDTLLGTLVKELQNKYTPGRREEAIAVTMRFLRSVARVFVILS
VEMASSKKKNNFIPQPIGKCKRVFQALLPYAVEELCNVAESLIVPVRMGIARPTAPFTLA
STSIDAMQGSEELFSVEPLPPRPSSDQSSSSSQSQSSYIIRNPQQRRISQSQPVRGRDEE
QDDIVSADVEEVEVVEGVAGEEDHHDEQEEHGEENAEAEGQHDEHDEDGSDMELDLLAAA
ETESDSESNHSNQDNASGRRSVVTAATAGSEAGASSVPAFFSEDDSQSNDSSDSDSSSSQ
SDDIEQETFMLDEPLERTTNSSHANGAAQAPRSMQWAVRNTQHQRAASTAPSSTSTPAAS
SAGLIYIDPSNLRRSGTISTSAAAAAAALEASNASSYLTSASSLARAYSIVIRQISDLMG
LIPKYNHLVYSQIPAAVKLTYQDAVNLQNYVEEKLIPTWNWMVSIMDSTEAQLRYGSALA
SAGDPGHPNHPLHASQNSARRERMTAREEASLRTLEGRRRATLLSARQGMMSARGDFLNY
ALSLMRSHNDEHSDVLPVLDVCSLKHVAYVFQALIYWIKAMNQQTTLDTPQLERKRTREL
LELGIDNEDSEHENDDDTNQSATLNDKDDDSLPAETGQNHPFFRRSDSMTFLGCIPPNPF
EVPLAEAIPLADQPHLLQPNARKEDLFGRPSQGLYSSSASSGKCLMEVTVDRNCLEVLPT
KMSYAANLKNVMNMQNRQKKEGEEQPVLPEETESSKPGPSAHDLAAQLKSSLLAEIGLTE
SEGPPLTSFRPQCSFMGMVISHDMLLGRWRLSLELFGRVFMEDVGAEPGSILTELGGFEV
KESKFRREMEKLRNQQSRDLSLEVDRDRDLLIQQTMRQLNNHFGRRCATTPMAVHRVKVT
FKDEPGEGSGVARSFYTAIAQAFLSNEKLPNLECIQNANKGTHTSLMQRLRNRGERDRER
EREREMRRSSGLRAGSRRDRDRDFRRQLSIDTRPFRPASEGNPSDDPEPLPAHRQALGER
LYPRVQAMQPAFASKITGMLLELSPAQLLLLLASEDSLRARVDEAMELIIAHGRENGADS
ILDLGLVDSSEKVQQENRKRHGSSRSVVDMDLDDTDDGDDNAPLFYQPGKRGFYTPRPGK
NTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLR
QLILASQSSDADAVFSAMDLAFAIDLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAE
HRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDES
GENAEKLLQFKRWFWSIVEKMSMTERQDLVYFWTSSPSLPASEEGFQPMPSITIRPPDDQ
HLPTANTCISRLYVPLYSSKQILKQKLLLAIKTKNFGFV
NT seq 8400 nt NT seq  +upstreamnt  +downstreamnt
atgacgtccatccatttcgtggttcacccgctgccgggcaccgaggaccagctcaatgac
aggttacgagaagtttctgagaagctgaacaaatataatttaaacagccacccccctttg
aatgtattggaacaggctactattaaacagtgtgtggtgggaccaaatcatgctgccttt
cttcttgaggatggtagagtttgcaggattggtttttcagtacagccagacagattggaa
ttgggtaaacctgataataatgatgggtcaaagttgaacagcaactcgggggcagggagg
acgtcaaggcctggtaggacaagcgactctccatggtttctctcaggttctgagactcta
ggcaggctggcaggcaacaccttaggaagccgctggagttctggagtgggtggaagtggt
ggaggatcctctggtaggtcatcagctggagctcgagattcccgccggcagactcgagtt
attcggacaggacgggatcgagggtctgggcttttgggcagtcagccccagccagttatt
ccagcatctgtcattccagaggagctgatttcacaggcccaagttgttttacaaggcaaa
tccagaagtgtcattattcgagaacttcagagaacaaatcttgatgtgaaccttgctgta
aataatttacttagccgggatgatgaagatggagatgatggggatgatacagccagcgaa
tcttatttgcctggagaggatcttatgtctctccttgatgccgacattcattctgcccac
ccaagtgtcattattgatgcagatgccatgttttctgaagacattagctattttggttac
ccttcttttcgtcgttcatcactttccaggctaggctcatctcgagttctccttcttccc
ttagagagagactctgagctgttgcgtgaacgtgaatccgttttacgtttacgtgaacga
aggtggcttgatggagcctcatttgataatgaaaggggttctaccagcaaggaaggagag
ccaaacttggataagaagaatacacctgttcaaagtccagtatctctaggagaagatttg
cagtggtggcctgataaggatggaacaaaattcatctgtattggggctctgtattctgaa
cttctggctgtcagcagtaaaggagaactttatcagtggaaatggagtgaatctgagcct
tacagaaatgcccagaatccttcattacatcatccacgagcaacatttttggggttaacc
aatgaaaagatagtcctcctgtctgcaaatagcataagagcaactgtagctacagaaaat
aacaaggttgctacatgggtggatgaaactttaagttctgtggcttctaaattagagcac
actgctcagacttactctgaacttcaaggagagcggatagtttctttacattgctgtgcc
ctttacacctgcgctcagctggaaaacagtttatattggtggggtgtagttccttttagt
caaaggaagaaaatgttagagaaagctagagcaaaaaataaaaagcctaaatccagtgct
ggtatttcttcaatgccgaacatcactgttggtacccaggtatgcttgagaaataatcct
ctttatcatgctggagcagttgcattttcaattagtgctgggattcctaaagttggtgtc
ttaatggagtcagtttggaatatgaatgacagctgtagatttcaacttagatctcctgaa
agcttgaaaaacatggaaaaagctagcaaaactactgaagctaagcctgaaagtaagcag
gagccagtgaaaacagaaatgggtcctccaccatctccagcatccacgtgtagtgatgca
tcctcaattgccagcagtgcatcaatgccatacaaacgacgacggtcaacccctgcacca
aaagaagaggaaaaggtgaatgaagagcagtggtctcttcgggaagtggtttttgtggaa
gatgtcaagaatgttcctgttggcaaggtgctaaaagtagatggtgcctatgttgctgta
aaatttccaggaacctccagtaatactaactgtcagaacagctctggtccagatgctgac
ccttcttctctcctgcaggattgtaggttacttagaattgatgaattgcaggttgtcaaa
actggtggaacaccgaaggttcccgactgtttccaaaggactcctaaaaagctttgtata
cctgaaaaaacagaaatattagcagtgaatgtagattccaaaggtgttcatgctgttctg
aagactggaaattgggtacgatactgtatctttgatcttgctacaggaaaagcagaacag
gaaaataattttcctacaagcagcattgctttccttggtcagaatgagaggaatgtagcc
attttcactgctggacaggaatctcccattattcttcgagatggaaatggtaccatctac
ccaatggccaaagattgcatgggaggaataagggatcccgattggctggatcttccacct
attagtagtcttggaatgggtgtgcattctttaataaatcttcctgccaattcaacaatc
aaaaagaaagctgctgttatcatcatggctgtagagaaacaaaccttaatgcaacacatt
ctgcgctgtgactatgaggcctgtcgacaatatctaatgaatcttgagcaagcggttgtt
ttagagcagaatctacagatgctgcagacattcatcagccacagatgtgatggaaatcga
aatattttgcatgcttgtgtatcagtttgctttccaaccagcaataaagaaactaaagaa
gaagaggaagcggagcgttctgaaagaaatacatttgcagaaaggctttctgctgttgag
gccattgcaaatgcaatatcagttgtttcaagtaatggcccaggtaatcgggctggatca
tcaagtagccgaagtttgagattacgggaaatgatgagacgttcgttgagagcagctggt
ttgggtagacatgaagctggagcttcatccagtgaccaccaggatccagtttcacccccc
atagctccccctagttgggttcctgaccctcctgcgatggatcctgatggtgacattgat
tttatcctggcccccgctgtgggatctcttaccacagcagcaaccggtactggtcaagga
ccaagcacctccactattccaggtccttccacagagccatctgtagtagaatccaaggat
cgaaaggcgaatgctcattttatattgaaattgttatgtgacagtgtggttctccagccc
tatctacgagaacttctttctgccaaggatgcaagagggatgaccccatttatgtcagct
gtaagtggccgagcttatcctgctgcaattaccatcttagaaactgctcagaaaattgca
aaagctgaaatatcctcaagtgaaaaagaggaagatgtattcatgggaatggtttgccca
tcaggtaccaaccctgatgactctcctttatatgttttatgttgtaatgacacttgcagt
tttacatggactggagcagagcacattaaccaggatatttttgagtgtcgaacttgtggc
ttgctggagtcactgtgttgttgtacggaatgtgcaagggtttgtcataaaggtcatgat
tgcaaactcaaacggacatcaccaacagcctactgtgattgttgggagaaatgtaaatgt
aaaactcttattgctggacagaaatctgctcgtcttgatctactttatcgcctgctcact
gctactaatctggttactctgccaaacagcaggggagagcacctcttactattcttagta
cagacagtcgcaaggcagacggtggagcattgtcaatacaggccacctcgaatcagggaa
gatcgtaaccgaaaaacagccagtcctgaagattcagatatgccagatcatgatttagag
cctccaagatttgcccagcttgcattggagcgtgttctacaggactggaatgccttgaaa
tctatgattatgtttgggtcgcaggagaataaagaccctcttagtgccagcagtagaata
ggccatcttttgccagaagagcaagtatacctcaatcagcaaagtggcacaattcggctg
gactgtttcactcattgccttatagttaagtgtacagcagatattttgcttttagatact
ctactaggtacactagtgaaagaactccaaaacaaatatacacctggacgtagagaagaa
gctattgctgtgacaatgaggtttctacgttcagtggcaagagtttttgttattctgagt
gtggaaatggcttcatccaaaaagaaaaacaactttattccacagccaattggaaaatgc
aagcgtgtattccaagcattgctaccttacgctgtggaagaattgtgcaacgtagcagag
tcactgattgttcctgtcagaatggggattgctcgtccaactgcaccatttaccctggct
agtactagcatagatgccatgcagggcagtgaagaattattttcagtggaaccactacca
ccacgaccatcatctgatcagtctagcagctccagtcagtctcagtcatcctacatcatc
aggaatccacagcagaggcgcatcagccagtcacagcccgttcggggcagagatgaagaa
caggatgatattgtttcagcagatgtggaagaggttgaggtggtggagggtgtggctgga
gaagaggatcatcatgatgaacaggaagaacacggggaagaaaatgctgaggcagaggga
caacatgatgagcatgatgaagacgggagtgatatggagctggacttgttagcagcagct
gaaacagaaagtgatagtgaaagtaaccacagcaaccaagataatgctagtgggcgcaga
agcgttgtcactgcagcaactgctggttcagaagcaggagcaagcagtgttcctgccttc
ttttctgaagatgattctcaatcgaatgactcaagtgattctgatagcagtagtagtcag
agtgacgacatagaacaggagacctttatgcttgatgagccattagaaagaaccacaaat
agctcccatgccaatggtgctgcccaagctccccgttcaatgcagtgggctgtccgcaac
acccagcatcagcgagcagccagtacagccccttccagtacatctacaccagcagcaagt
tcagcgggtttgatttatattgatccttcaaacttacgccggagtggtaccatcagtaca
agtgctgcagctgcagcagctgctttggaagctagcaacgccagcagttacctaacatct
gcaagcagtttagccagggcttacagcattgtcattagacaaatctcggacttgatgggc
cttattcctaagtataatcacctagtatactctcagattccagcagctgtgaaattgact
taccaagatgcagtaaacttacagaactatgtagaagaaaagcttattcccacttggaac
tggatggtcagtattatggattctactgaagctcaattacgttatggttctgcattagca
tctgctggtgatcctggacatccaaatcatcctcttcacgcttctcagaattcagcgaga
agagagaggatgactgcgcgagaagaagctagcttacgaacacttgaaggcagacgacgt
gccaccttgcttagcgcccgtcaaggaatgatgtctgcacgaggagacttcctaaattat
gctctgtctctaatgcggtctcataatgatgagcattctgatgttcttccagttttggat
gtttgctcattgaagcatgtggcatatgtttttcaagcacttatatactggattaaggca
atgaatcagcagacaacattggatacacctcaactagaacgcaaaaggacgcgagaactc
ttggaactgggtattgataatgaagattcagaacatgaaaatgatgatgacaccaatcaa
agtgctactttgaatgataaggatgatgactctcttcctgcagaaactggccaaaaccat
ccatttttccgacgttcagactccatgacattccttgggtgtatacccccaaatccattt
gaagtgcctctggctgaagccatccccttggctgatcagccacatctgttgcagccaaat
gctagaaaggaggatctttttggccgtccaagtcagggtctttattcttcatctgccagt
agtgggaaatgtttaatggaggttacagtggatagaaactgcctagaggttcttccaaca
aaaatgtcttatgctgccaatctgaaaaatgtaatgaacatgcaaaaccggcaaaaaaaa
gaaggggaagaacagcccgtgctgccagaagaaactgagagttcaaaaccagggccatct
gctcatgatcttgctgcacaattaaaaagtagcttactagcagaaataggacttactgaa
agtgaagggccacctctcacatctttcaggccacagtgtagctttatgggaatggttatt
tcccatgatatgctgctaggacgttggcgcctttctttagaactgttcggcagggtattc
atggaagatgttggagcagaacctggatcaatcctaactgaattgggtggttttgaggta
aaagaatcaaaattccgcagagaaatggaaaaactgagaaaccagcagtcaagagatttg
tcactagaggttgatcgggatcgagatcttctcattcagcagactatgaggcagcttaac
aatcactttggtcgaagatgtgctactacaccaatggctgtacacagagtaaaagtcaca
tttaaggatgagccaggagagggcagtggtgtagcacgaagtttttatacagccattgca
caagcatttttatcaaatgaaaaattgccaaatctagagtgtatccaaaatgccaacaaa
ggcacccacacaagtttaatgcagagattaaggaaccgaggagagagagaccgggaaagg
gagagagaaagggaaatgaggaggagtagtggtttgcgagcaggttctcggagggaccgg
gatagagactttagaagacagctttccatcgacactaggccctttagaccagcctctgaa
gggaatcctagcgatgatcctgagcctttgccagcacatcggcaggcacttggagagagg
ctttatcctcgtgtacaagcaatgcaaccagcatttgcaagtaaaatcactggcatgttg
ttggaattatccccagctcagctgcttctccttctagcaagtgaggattctctgagagca
agagtggatgaggccatggaactcattattgcacatggacgggaaaatggagctgatagt
atcctggatcttggattagtagactcctcagaaaaggtacagcaggaaaaccgaaagcgc
catggctctagtcgaagtgtagtagatatggatttagatgatacagatgatggtgatgac
aatgcccctttgttttaccaacctgggaaaagaggattttatactccaaggcctggcaag
aacacagaagcaaggttgaattgtttcagaaacattggcaggattcttggactatgtctg
ttacagaatgaactatgtcctatcacattgaatagacatgtaattaaagtattgcttggt
agaaaagtcaattggcatgattttgctttttttgatcctgtaatgtatgagagtttgcgg
caactaatcctcgcgtctcagagttcagatgctgatgctgttttctcagcaatggatttg
gcatttgcaattgacctgtgtaaagaagaaggtggaggacaggttgaactcattcctaat
ggtgtaaatataccagtcactccacagaatgtatatgagtatgtgcggaaatacgcagaa
cacagaatgttggtagttgcagaacagcccttacatgcaatgaggaaaggtctactagat
gtgcttccaaaaaattcattagaagatttaacggcagaagattttaggcttttggtaaat
ggctgcggtgaagtcaatgtgcaaatgctgatcagttttacctctttcaatgatgaatca
ggagaaaatgctgagaagcttctgcagttcaagcgttggttctggtcaatagtagagaag
atgagcatgacagaacgacaagatcttgtttacttttggacatcaagcccatcactgcca
gccagtgaagaaggattccagcctatgccctcaatcacaataagaccaccagatgaccaa
catcttcctactgcaaatacttgcatttctcgactttacgtcccactctattcctctaaa
cagattctcaaacagaaattgttactcgccattaagaccaagaattttggttttgtgtag

DBGET integrated database retrieval system