KEGG   Homo sapiens (human): 51377Help
Entry
51377             CDS       T01001                                 

Gene name
UCHL5, CGI-70, INO80R, UCH-L5, UCH37
Definition
ubiquitin carboxyl-terminal hydrolase L5 (EC:3.4.19.12)
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     51377 (UCHL5)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   51377 (UCHL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q32
AA seq 328 aa AA seqDB search
MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQP
GEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQS
FDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDG
LREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQR
QLAEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLK
TLAEHQQLIPLVEKAKEKQNAKKAQETK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgacgggcaatgccggggagtggtgcctcatggaaagcgaccccggggtcttcaccgag
ctcattaaaggattcggttgccgaggagcccaagtagaagaaatatggagtttagagcct
gagaattttgaaaaattaaagccagttcatgggttaatttttcttttcaagtggcagcca
ggagaagaaccagcaggctctgtggttcaggactcccgacttgacacgatattttttgct
aagcaggtaattaataatgcttgtgctactcaagccatagtgagtgtgttactgaactgt
acccaccaggatgtccatttaggcgagacattatcagagtttaaagaattttcacaaagt
tttgatgcagctatgaaaggcttggcactgagcaattcagatgtgattcgacaagtacac
aacagtttcgccagacagcaaatgtttgaatttgatacgaagacatcagcaaaagaagaa
gatgcttttcactttgtcagttatgttcctgttaatgggagactgtatgaattagatgga
ttaagagaaggaccgattgatttaggtgcatgcaatcaagatgattggatcagtgcagta
aggcctgtcatagaaaaaaggatacaaaagtacagtgaaggtgaaattcgatttaattta
atggccattgtgtctgacagaaaaatgatatatgagcagaagatagcagagttacaaaga
caacttgcagaggaacccatggatacagatcaaggtaatagtatgttaagtgctattcag
tcagaagttgccaaaaatcagatgcttattgaagaagaagtacagaaattaaaaagatac
aagattgagaatatcagaaggaagcataattatctgcctttcattatggaattgttaaag
actttagcagaacaccagcagttaataccactagtagaaaaggcaaaagaaaaacagaac
gcaaagaaagctcaggaaaccaaatga

DBGET integrated database retrieval system