KEGG   Homo sapiens (human): 51378Help
Entry
51378             CDS       T01001                                 

Gene name
ANGPT4, AGP4, ANG-3, ANG4
Definition
angiopoietin 4
Orthology
K05467  
angiopoietin 4
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
HIF-1 signaling pathway
PI3K-Akt signaling pathway
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:hsa04014]
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:hsa04066]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
20p13
AA seq 503 aa AA seqDB search
MLSQLAMLQGSLLLVVATMSVAQQTRQEADRGCETLVVQHGHCSYTFLLPKSEPCPPGPE
VSRDSNTLQRESLANPLHLGKLPTQQVKQLEQALQNNTQWLKKLERAIKTILRSKLEQVQ
QQMAQNQTAPMLELGTSLLNQTTAQIRKLTDMEAQLLNQTSRMDAQMPETFLSTNKLENQ
LLLQRQKLQQLQGQNSALEKRLQALETKQQEELASILSKKAKLLNTLSRQSAALTNIERG
LRGVRHNSSLLQDQQHSLRQLLVLLRHLVQERANASAPAFIMAGEQVFQDCAEIQRSGAS
ASGVYTIQVSNATKPRKVFCDLQSSGGRWTLIQRRENGTVNFQRNWKDYKQGFGDPAGEH
WLGNEVVHQLTRRAAYSLRVELQDWEGHEAYAQYEHFHLGSENQLYRLSVVGYSGSAGRQ
SSLVLQNTSFSTLDSDNDHCLCKCAQVMSGGWWFDACGLSNLNGVYYHAPDNKYKMDGIR
WHYFKGPSYSLRASRMMIRPLDI
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgctctcccagctagccatgctgcagggcagcctcctccttgtggttgccaccatgtct
gtggctcaacagacaaggcaggaggcggataggggctgcgagacacttgtagtccagcac
ggccactgtagctacaccttcttgctgcccaagtctgagccctgccctccggggcctgag
gtctccagggactccaacaccctccagagagaatcactggccaacccactgcacctgggg
aagttgcccacccagcaggtgaaacagctggagcaggcactgcagaacaacacgcagtgg
ctgaagaagctagagagggccatcaagacgatcttgaggtcgaagctggagcaggtccag
cagcaaatggcccagaatcagacggcccccatgctagagctgggcaccagcctcctgaac
cagaccactgcccagatccgcaagctgaccgacatggaggctcagctcctgaaccagaca
tcaagaatggatgcccagatgccagagacctttctgtccaccaacaagctggagaaccag
ctgctgctacagaggcagaagctccagcagcttcagggccaaaacagcgcgctcgagaag
cggttgcaggccctggagaccaagcagcaggaggagctggccagcatcctcagcaagaag
gcgaagctgctgaacacgctgagccgccagagcgccgccctcaccaacatcgagcgcggc
ctgcgcggtgtcaggcacaactccagcctcctgcaggaccagcagcacagcctgcgccag
ctgctggtgttgttgcggcacctggtgcaagaaagggctaacgcctcggccccggccttc
ataatggcaggtgagcaggtgttccaggactgtgcagagatccagcgctctggggccagt
gccagtggtgtctacaccatccaggtgtccaatgcaacgaagcccaggaaggtgttctgt
gacctgcagagcagtggaggcaggtggaccctcatccagcgccgtgagaatggcaccgtg
aattttcagcggaactggaaggattacaaacagggcttcggagacccagctggggagcac
tggctgggcaatgaagtggtgcaccagctcaccagaagggcagcctactctctgcgtgtg
gagctgcaagactgggaaggccacgaggcctatgcccagtacgaacatttccacctgggc
agtgagaaccagctatacaggctttctgtggtcgggtacagcggctcagcagggcgccag
agcagcctggtcctgcagaacaccagctttagcacccttgactcagacaacgaccactgt
ctctgcaagtgtgcccaagtgatgtctggagggtggtggtttgacgcctgtggcctgtca
aacctcaacggcgtctactaccacgctcccgacaacaagtacaagatggacggcatccgc
tggcactacttcaagggccccagctactcactgcgtgcctctcgcatgatgatacggcct
ttggacatctaa

DBGET integrated database retrieval system