KEGG   Homo sapiens (human): 51382Help
Entry
51382             CDS       T01001                                 

Gene name
ATP6V1D, ATP6M, VATD, VMA8
Definition
ATPase, H+ transporting, lysosomal 34kDa, V1 subunit D (EC:3.6.3.14)
Orthology
K02149  
V-type H+-transporting ATPase subunit D
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Phagosome
Synaptic vesicle cycle
Collecting duct acid secretion
Vibrio cholerae infection
Epithelial cell signaling in Helicobacter pylori infection
Rheumatoid arthritis
Module
V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    51382 (ATP6V1D)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    51382 (ATP6V1D)
 Organismal Systems
  Excretory system
   04966 Collecting duct acid secretion
    51382 (ATP6V1D)
  Nervous system
   04721 Synaptic vesicle cycle
    51382 (ATP6V1D)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    51382 (ATP6V1D)
  Infectious diseases
   05110 Vibrio cholerae infection
    51382 (ATP6V1D)
   05120 Epithelial cell signaling in Helicobacter pylori infection
    51382 (ATP6V1D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
14q23-q24.2
AA seq 247 aa AA seqDB search
MSGKDRIEIFPSRMAQTIMKARLKGAQTGRNLLKKKSDALTLRFRQILKKIIETKMLMGE
VMREAAFSLAEAKFTAGDFSTTVIQNVNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYE
LTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPRI
ERTLAYIITELDEREREEFYRLKKIQEKKKILKEKSEKDLEQRRAAGEVLEPANLLAEEK
DEDLLFE
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggcaaagaccgaattgaaatctttccctcgcgaatggcacagaccatcatgaag
gctcgtttaaagggagcacagacaggtcgaaacctcctgaagaaaaaatctgatgcctta
actcttcgatttcgacagatcctaaagaagataatagagactaaaatgttgatgggcgaa
gtgatgagagaagctgccttttcactagctgaagccaagttcacagcaggtgacttcagc
actacagttatccaaaatgtcaataaagcgcaagtgaagattcgagcgaagaaagataat
gtagcaggtgttactttgccagtatttgaacattaccatgaaggaactgacagttatgaa
ctgactggtttagccagaggtggggaacagttggctaaattaaagaggaattatgccaaa
gcagtggaactactggtggaactagcttctctgcagacttcttttgttactttggatgaa
gctattaagataaccaacaggcgtgtaaatgccattgaacatgtcatcattccccggatt
gaacgtactcttgcttatatcatcacagagctggatgagagagagcgagaagagttctat
aggttaaagaaaatacaagagaagaaaaagattctaaaggaaaaatctgagaaggacttg
gagcaaaggagagcagctggagaggtgttggagcctgctaatcttctggctgaagagaag
gacgaggatcttctatttgaataa

DBGET integrated database retrieval system