KEGG   Homo sapiens (human): 51393Help
Entry
51393             CDS       T01001                                 

Gene name
TRPV2, VRL, VRL-1, VRL1
Definition
(RefSeq) transient receptor potential cation channel subfamily V member 2
  KO
K04971  
transient receptor potential cation channel subfamily V member 2
Organism
hsa  Homo sapiens (human)
Pathway
Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    51393 (TRPV2)
Ion channels [BR:hsa04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPV (Vanilloid)
   51393 (TRPV2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17p11.2
AA seq 764 aa AA seqDB search
MTSPSSSPVFRLETLDGGQEDGSEADRGKLDFGSGLPPMESQFQGEDRKFAPQIRVNLNY
RKGTGASQPDPNRFDRDRLFNAVSRGVPEDLAGLPEYLSKTSKYLTDSEYTEGSTGKTCL
MKAVLNLKDGVNACILPLLQIDRDSGNPQPLVNAQCTDDYYRGHSALHIAIEKRSLQCVK
LLVENGANVHARACGRFFQKGQGTCFYFGELPLSLAACTKQWDVVSYLLENPHQPASLQA
TDSQGNTVLHALVMISDNSAENIALVTSMYDGLLQAGARLCPTVQLEDIRNLQDLTPLKL
AAKEGKIEIFRHILQREFSGLSHLSRKFTEWCYGPVRVSLYDLASVDSCEENSVLEIIAF
HCKSPHRHRMVVLEPLNKLLQAKWDLLIPKFFLNFLCNLIYMFIFTAVAYHQPTLKKQAA
PHLKAEVGNSMLLTGHILILLGGIYLLVGQLWYFWRRHVFIWISFIDSYFEILFLFQALL
TVVSQVLCFLAIEWYLPLLVSALVLGWLNLLYYTRGFQHTGIYSVMIQKVILRDLLRFLL
IYLVFLFGFAVALVSLSQEAWRPEAPTGPNATESVQPMEGQEDEGNGAQYRGILEASLEL
FKFTIGMGELAFQEQLHFRGMVLLLLLAYVLLTYILLLNMLIALMSETVNSVATDSWSIW
KLQKAISVLEMENGYWWCRKKQRAGVMLTVGTKPDGSPDERWCFRVEEVNWASWEQTLPT
LCEDPSGAGVPRTLENPVLASPPKEDEDGASEENYVPVQLLQSN
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgacctcaccctccagctctccagttttcaggttggagacattagatggaggccaagaa
gatggctctgaggcggacagaggaaagctggattttgggagcgggctgcctcccatggag
tcacagttccagggcgaggaccggaaattcgcccctcagataagagtcaacctcaactac
cgaaagggaacaggtgccagtcagccggatccaaaccgatttgaccgagatcggctcttc
aatgcggtctcccggggtgtccccgaggatctggctggacttccagagtacctgagcaag
accagcaagtacctcaccgactcggaatacacagagggctccacaggtaagacgtgcctg
atgaaggctgtgctgaaccttaaggacggagtcaatgcctgcattctgccactgctgcag
atcgacagggactctggcaatcctcagcccctggtaaatgcccagtgcacagatgactat
taccgaggccacagcgctctgcacatcgccattgagaagaggagtctgcagtgtgtgaag
ctcctggtggagaatggggccaatgtgcatgcccgggcctgcggccgcttcttccagaag
ggccaagggacttgcttttatttcggtgagctacccctctctttggccgcttgcaccaag
cagtgggatgtggtaagctacctcctggagaacccacaccagcccgccagcctgcaggcc
actgactcccagggcaacacagtcctgcatgccctagtgatgatctcggacaactcagct
gagaacattgcactggtgaccagcatgtatgatgggctcctccaagctggggcccgcctc
tgccctaccgtgcagcttgaggacatccgcaacctgcaggatctcacgcctctgaagctg
gccgccaaggagggcaagatcgagattttcaggcacatcctgcagcgggagttttcagga
ctgagccacctttcccgaaagttcaccgagtggtgctatgggcctgtccgggtgtcgctg
tatgacctggcttctgtggacagctgtgaggagaactcagtgctggagatcattgccttt
cattgcaagagcccgcaccgacaccgaatggtcgttttggagcccctgaacaaactgctg
caggcgaaatgggatctgctcatccccaagttcttcttaaacttcctgtgtaatctgatc
tacatgttcatcttcaccgctgttgcctaccatcagcctaccctgaagaagcaggccgcc
cctcacctgaaagcggaggttggaaactccatgctgctgacgggccacatccttatcctg
ctaggggggatctacctcctcgtgggccagctgtggtacttctggcggcgccacgtgttc
atctggatctcgttcatagacagctactttgaaatcctcttcctgttccaggccctgctc
acagtggtgtcccaggtgctgtgtttcctggccatcgagtggtacctgcccctgcttgtg
tctgcgctggtgctgggctggctgaacctgctttactatacacgtggcttccagcacaca
ggcatctacagtgtcatgatccagaaggtcatcctgcgggacctgctgcgcttccttctg
atctacttagtcttccttttcggcttcgctgtagccctggtgagcctgagccaggaggct
tggcgccccgaagctcctacaggccccaatgccacagagtcagtgcagcccatggaggga
caggaggacgagggcaacggggcccagtacaggggtatcctggaagcctccttggagctc
ttcaaattcaccatcggcatgggcgagctggccttccaggagcagctgcacttccgcggc
atggtgctgctgctgctgctggcctacgtgctgctcacctacatcctgctgctcaacatg
ctcatcgccctcatgagcgagaccgtcaacagtgtcgccactgacagctggagcatctgg
aagctgcagaaagccatctctgtcctggagatggagaatggctattggtggtgcaggaag
aagcagcgggcaggtgtgatgctgaccgttggcactaagccagatggcagccccgatgag
cgctggtgcttcagggtggaggaggtgaactgggcttcatgggagcagacgctgcctacg
ctgtgtgaggacccgtcaggggcaggtgtccctcgaactctcgagaaccctgtcctggct
tcccctcccaaggaggatgaggatggtgcctctgaggaaaactatgtgcccgtccagctc
ctccagtccaactga

DBGET integrated database retrieval system