KEGG   Homo sapiens (human): 51400Help
Entry
51400             CDS       T01001                                 

Gene name
PPME1, PME-1
Definition
(RefSeq) protein phosphatase methylesterase 1 (EC:3.1.1.89)
  KO
K13617  
protein phosphatase methylesterase 1 [EC:3.1.1.89]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.89  protein phosphatase methylesterase-1
     51400 (PPME1)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S33
   51400 (PPME1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q13.4
AA seq 386 aa AA seqDB search
MSALEKSMHLGRLPSRPPLPGSGGSQSGAKMRMGPGRKRDFSPVPWSQYFESMEDVEVEN
ETGKDTFRVYKSGSEGPVLLLLHGGGHSALSWAVFTAAIISRVQCRIVALDLRSHGETKV
KNPEDLSAETMAKDVGNVVEAMYGDLPPPIMLIGHSMGGAIAVHTASSNLVPSLLGLCMI
DVVEGTAMDALNSMQNFLRGRPKTFKSLENAIEWSVKSGQIRNLESARVSMVGQVKQCEG
ITSPEGSKSIVEGIIEEEEEDEEGSESISKRKKEDDMETKKDHPYTWRIELAKTEKYWDG
WFRGLSNLFLSCPIPKLLLLAGVDRLDKDLTIGQMQGKFQMQVLPQCGHAVHEDAPDKVA
EAVATFLIRHRFAEPIGGFQCVFPGC
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgtcggccctcgaaaagagcatgcacctcggccgccttccctctcgcccacctctaccc
ggcagcgggggcagtcagagcggagccaagatgcgaatgggccctggaagaaagcgggac
ttttcccctgttccttggagtcagtattttgagtccatggaagatgtagaagtagagaat
gaaactggcaaggatacttttcgagtctacaagagtggttcagagggtccagtcctgctc
cttctgcatggaggaggtcattctgccctttcttgggctgtgttcacggcagcgattatt
agtagagttcagtgtaggattgtagctttggatctgcgaagtcatggtgaaacaaaggtc
aagaatcctgaagatctgtctgcagaaacaatggcaaaagacgttggcaatgtggttgaa
gccatgtatggggaccttcctcctccaattatgctgattggacatagcatgggtggtgct
attgcagtccacacagcatcatccaacctggtaccaagcctcttgggtctgtgcatgatt
gatgttgtagaaggtacagctatggatgcacttaatagcatgcagaatttcttacggggt
cgtcctaaaaccttcaagtctctggagaatgctattgaatggagtgtgaagagtggccag
attcgaaatctggagtctgcccgtgtctcaatggttggccaagtcaaacagtgtgaagga
attacaagtccagaaggctcaaaatctatagtggaaggaatcatagaggaagaagaagaa
gatgaggaaggaagtgagtctataagcaagaggaaaaaggaagatgacatggagaccaag
aaagaccatccatacacctggagaattgaactggcaaaaacagaaaaatactgggacggc
tggttccgaggcttatccaatctctttcttagttgtcccattcctaaattgctgctcttg
gctggtgttgatagattggataaagatctgaccattggccagatgcaagggaagttccag
atgcaggtcctaccccagtgtggccatgcagtccatgaggatgcccctgacaaggtagct
gaagctgttgccactttcctgatccggcacaggtttgcagaacccatcggtggattccag
tgtgtgtttcctggctgttag

DBGET integrated database retrieval system