KEGG   Homo sapiens (human): 51433Help
Entry
51433             CDS       T01001                                 

Gene name
ANAPC5, APC5
Definition
anaphase promoting complex subunit 5
Orthology
K03352  
anaphase-promoting complex subunit 5
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
HTLV-I infection
Module
APC/C complex
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:hsa04120]
Cellular Processes; Cell growth and death; Cell cycle [PATH:hsa04110]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:hsa04114]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:hsa04914]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:hsa05166]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q24.31
AA seq 643 aa AA seqDB search
MAEGELKDMEQFFDDLSDSFSGTEPEVHKTSVVGLFLRHMILAYSKLSFSQVFKLYTALQ
QYFQNGEKKTVEDADMELTSRDEGERKMEKEELDVSVREEEVSCSGPLSQKQAEFFLSQQ
ASLLKNDETKALTPASLQKELNNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYFD
RLILTGAESKSNGEEGYGRSLRYAALNLAALHCRFGHYQQAELALQEAIRIAQESNDHVC
LQHCLSWLYVLGQKRSDSYVLLEHSVKKAVHFGLPRAFAGKTANKLMDALKDSDLLHWKH
SLSELIDISIAQKTAIWRLYGRSTMALQQAQMLLSMNSLEAVNAGVQQNNTESFAVALCH
LAELHAEQGCFAAASEVLKHLKERFPPNSQHAQLWMLCDQKIQFDRAMNDGKYHLADSLV
TGITALNSIEGVYRKAVVLQAQNQMSEAHKLLQKLLVHCQKLKNTEMVISVLLSVAELYW
RSSSPTIALPMLLQALALSKEYRLQYLASETVLNLAFAQLILGIPEQALSLLHMAIEPIL
ADGAILDKGRAMFLVAKCQVASAASYDQPKKAEALEAAIENLNEAKNYFAKVDCKERIRD
VVYFQARLYHTLGKTQERNRCAMLFRQLHQELPSHGVPLINHL
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaggcgagttgaaggatatggaacagttttttgatgacctttcagattctttc
tctggaactgaaccagaggttcacaaaacaagtgtagtaggtttgtttctgcgtcacatg
atcttggcctacagtaagctttctttcagccaagtgtttaaactgtacactgcccttcag
cagtacttccagaatggtgagaaaaagacagtggaggatgctgatatggaactgaccagt
agagatgagggtgaaagaaaaatggaaaaagaagaacttgatgtatctgtaagagaagag
gaggtatcttgcagtgggcctctgtcccaaaaacaagcagaattttttctttctcaacag
gcttctttgctaaagaatgatgagactaaggccctcactccagcttccttgcagaaggaa
ttaaacaatttgttgaaatttaatcctgattttgctgaagcgcattatctcagctactta
aacaacctccgtgtccaagatgttttcagttcaacacacagtctcctccattattttgat
cgtctgattcttaccggagccgaaagcaaaagtaatggggaagagggctatggccggagc
ttgagatacgccgctctgaatcttgccgccctgcactgccgcttcggtcactatcaacag
gcagagctcgccctgcaggaggcaattaggattgcccaggagtccaacgatcacgtgtgt
ctccagcactgtttgagctggctttatgtgctggggcagaagagatccgatagctatgtt
ctgctggagcattctgtgaagaaggcagtacattttgggttaccgagagcttttgctggg
aagacggcaaacaagctgatggatgccctaaaggactccgacctcctgcactggaaacac
agcctgtcagagctcatcgatatcagcatcgcacagaaaacggccatctggaggctgtat
ggccgcagcaccatggcactgcaacaggcccagatgttgctgagcatgaacagcctggag
gcggtgaatgcgggcgtgcagcagaacaacacagagtcctttgctgtcgcactctgccac
ctcgcagagctacacgcggagcagggctgttttgctgcagcttctgaagtgttaaagcac
ttgaaggaacgatttccgcctaatagtcagcacgcccagttatggatgctatgtgatcaa
aaaatacagtttgacagagcaatgaatgatggcaaatatcatttggctgattcacttgtt
acaggaatcacagctctcaatagcatagagggtgtttataggaaagcggttgtattacaa
gctcagaaccaaatgtcagaggcacataagcttttacaaaaattgttggttcattgtcag
aaactgaagaacacagaaatggtgatcagtgtcctactgtccgtggcagagctgtactgg
cgatcttcctcccctaccatcgcgctgcccatgctcctgcaggctctggccctctccaag
gagtaccggttacagtacttggcctctgaaacagtgctgaacttggcttttgcgcagctc
attcttggaatcccagaacaggccttaagtcttctccacatggccatcgagcccatcttg
gctgacggggctatcctggacaaaggtcgtgccatgttcttagtggccaagtgccaggtg
gcttcagcagcttcctacgatcagccgaagaaagcagaagctctggaggctgccatcgag
aacctcaatgaagccaagaactattttgcaaaggttgactgcaaagagcgcatcagggac
gtcgtttacttccaggccagactctaccataccctggggaagacccaggagaggaaccgg
tgtgcgatgctcttccggcagctgcatcaggagctgccctctcatggggtacccttgata
aaccatctctag

DBGET integrated database retrieval system