KEGG   Homo sapiens (human): 51433Help
Entry
51433             CDS       T01001                                 

Gene name
ANAPC5, APC5
Definition
anaphase promoting complex subunit 5
Orthology
K03352  
anaphase-promoting complex subunit 5
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
HTLV-I infection
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    51433 (ANAPC5)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    51433 (ANAPC5)
   04114 Oocyte meiosis
    51433 (ANAPC5)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    51433 (ANAPC5)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    51433 (ANAPC5)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     51433 (ANAPC5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q24.31
AA seq 643 aa AA seqDB search
MAEGELKDMEQFFDDLSDSFSGTEPEVHKTSVVGLFLRHMILAYSKLSFSQVFKLYTALQ
QYFQNGEKKTVEDADMELTSRDEGERKMEKEELDVSVREEEVSCSGPLSQKQAEFFLSQQ
ASLLKNDETKALTPASLQKELNNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYFD
RLILTGAESKSNGEEGYGRSLRYAALNLAALHCRFGHYQQAELALQEAIRIAQESNDHVC
LQHCLSWLYVLGQKRSDSYVLLEHSVKKAVHFGLPRAFAGKTANKLMDALKDSDLLHWKH
SLSELIDISIAQKTAIWRLYGRSTMALQQAQMLLSMNSLEAVNAGVQQNNTESFAVALCH
LAELHAEQGCFAAASEVLKHLKERFPPNSQHAQLWMLCDQKIQFDRAMNDGKYHLADSLV
TGITALNSIEGVYRKAVVLQAQNQMSEAHKLLQKLLVHCQKLKNTEMVISVLLSVAELYW
RSSSPTIALPMLLQALALSKEYRLQYLASETVLNLAFAQLILGIPEQALSLLHMAIEPIL
ADGAILDKGRAMFLVAKCQVASAASYDQPKKAEALEAAIENLNEAKNYFAKVDCKERIRD
VVYFQARLYHTLGKTQERNRCAMLFRQLHQELPSHGVPLINHL
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaggcgagttgaaggatatggaacagttttttgatgacctttcagattctttc
tctggaactgaaccagaggttcacaaaacaagtgtagtaggtttgtttctgcgtcacatg
atcttggcctacagtaagctttctttcagccaagtgtttaaactgtacactgcccttcag
cagtacttccagaatggtgagaaaaagacagtggaggatgctgatatggaactgaccagt
agagatgagggtgaaagaaaaatggaaaaagaagaacttgatgtatctgtaagagaagag
gaggtatcttgcagtgggcctctgtcccaaaaacaagcagaattttttctttctcaacag
gcttctttgctaaagaatgatgagactaaggccctcactccagcttccttgcagaaggaa
ttaaacaatttgttgaaatttaatcctgattttgctgaagcgcattatctcagctactta
aacaacctccgtgtccaagatgttttcagttcaacacacagtctcctccattattttgat
cgtctgattcttaccggagccgaaagcaaaagtaatggggaagagggctatggccggagc
ttgagatacgccgctctgaatcttgccgccctgcactgccgcttcggtcactatcaacag
gcagagctcgccctgcaggaggcaattaggattgcccaggagtccaacgatcacgtgtgt
ctccagcactgtttgagctggctttatgtgctggggcagaagagatccgatagctatgtt
ctgctggagcattctgtgaagaaggcagtacattttgggttaccgagagcttttgctggg
aagacggcaaacaagctgatggatgccctaaaggactccgacctcctgcactggaaacac
agcctgtcagagctcatcgatatcagcatcgcacagaaaacggccatctggaggctgtat
ggccgcagcaccatggcactgcaacaggcccagatgttgctgagcatgaacagcctggag
gcggtgaatgcgggcgtgcagcagaacaacacagagtcctttgctgtcgcactctgccac
ctcgcagagctacacgcggagcagggctgttttgctgcagcttctgaagtgttaaagcac
ttgaaggaacgatttccgcctaatagtcagcacgcccagttatggatgctatgtgatcaa
aaaatacagtttgacagagcaatgaatgatggcaaatatcatttggctgattcacttgtt
acaggaatcacagctctcaatagcatagagggtgtttataggaaagcggttgtattacaa
gctcagaaccaaatgtcagaggcacataagcttttacaaaaattgttggttcattgtcag
aaactgaagaacacagaaatggtgatcagtgtcctactgtccgtggcagagctgtactgg
cgatcttcctcccctaccatcgcgctgcccatgctcctgcaggctctggccctctccaag
gagtaccggttacagtacttggcctctgaaacagtgctgaacttggcttttgcgcagctc
attcttggaatcccagaacaggccttaagtcttctccacatggccatcgagcccatcttg
gctgacggggctatcctggacaaaggtcgtgccatgttcttagtggccaagtgccaggtg
gcttcagcagcttcctacgatcagccgaagaaagcagaagctctggaggctgccatcgag
aacctcaatgaagccaagaactattttgcaaaggttgactgcaaagagcgcatcagggac
gtcgtttacttccaggccagactctaccataccctggggaagacccaggagaggaaccgg
tgtgcgatgctcttccggcagctgcatcaggagctgccctctcatggggtacccttgata
aaccatctctag

DBGET integrated database retrieval system