KEGG   Homo sapiens (human): 51465Help
Entry
51465             CDS       T01001                                 

Gene name
UBE2J1, CGI-76, HSPC153, HSPC205, HSU93243, NCUBE-1, NCUBE1, UBC6, UBC6E, Ubc6p
Definition
(RefSeq) ubiquitin conjugating enzyme E2 J1
  KO
K10578  
ubiquitin-conjugating enzyme E2 J1 [EC:2.3.2.23]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Protein processing in endoplasmic reticulum
Parkinson's disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    51465 (UBE2J1)
   04120 Ubiquitin mediated proteolysis
    51465 (UBE2J1)
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    51465 (UBE2J1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     51465 (UBE2J1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   51465 (UBE2J1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q9Y385(Tbio)
UniProt: 
Position
6q15
AA seq 318 aa AA seqDB search
METRYNLKSPAVKRLMKEAAELKDPTDHYHAQPLEDNLFEWHFTVRGPPDSDFDGGVYHG
RIVLPPEYPMKPPSIILLTANGRFEVGKKICLSISGHHPETWQPSWSIRTALLAIIGFMP
TKGEGAIGSLDYTPEERRALAKKSQDFCCEGCGSAMKDVLLPLKSGSDSSQADQEAKELA
RQISFKAEVNSSGKTISESDLNHSFSLTDLQDDIPTTFQGATASTSYGLQNSSAASFHQP
TQPVAKNTSMSPRQRRAQQQSQRRLSTSPDVIQGHQPRDNHTDHGGSAVLIVILTLALAA
LIFRRIYLANEYIFDFEL
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggagacccgctacaacctgaagagtccggctgttaaacgtttaatgaaagaagcggca
gaattgaaagatccaacagatcattaccatgcgcagcctttagaggataacctttttgaa
tggcacttcacggttagagggcccccagactccgattttgatggaggagtttatcacggg
cggatagtactgccaccagagtatcccatgaaaccaccaagcattattctcctaacggct
aatggtcgatttgaagtgggcaagaaaatctgtttgagcatctcaggccatcatcctgaa
acttggcagccttcgtggagtataaggacagcattattagccatcattgggtttatgcca
acaaaaggagagggagccataggttctctagattacactcctgaggaaagaagagcactt
gccaaaaaatcacaagatttctgttgtgaaggatgtggctctgccatgaaggatgtcctg
ttgcctttaaaatctggaagcgattcaagccaagctgaccaagaagccaaagaactggct
aggcaaataagctttaaggcagaagtcaattcatctggaaagactatctctgagtcagac
ttaaaccactctttttcactaactgatttacaagatgatatacctacaacattccagggt
gctacggccagtacatcgtacggactccagaattcctcagcagcatcctttcatcaacct
acccaacctgtagctaagaatacctccatgagccctcgacagcgccgggcccagcagcag
agtcagagaaggttgtctacttcaccagatgtaatccagggccaccagccaagagacaac
cacactgatcatggtgggtcagctgtactgattgtcatcctgactttggcattggcagct
cttatattccgacgaatatatctggcaaacgaatacatatttgactttgagttataa

DBGET integrated database retrieval system