KEGG   Homo sapiens (human): 51466Help
Entry
51466             CDS       T01001                                 

Gene name
EVL, RNB6
Definition
(RefSeq) Enah/Vasp-like
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q32.2
AA seq 418 aa AA seqDB search
MATSEQSICQARASVMVYDDTSKKWVPIKPGQQGFSRINIYHNTASNTFRVVGVKLQDQQ
VVINYSIVKGLKYNQATPTFHQWRDARQVYGLNFASKEEATTFSNAMLFALNIMNSQEGG
PSSQRQVQNGPSPDEMDIQRRQVMEQHQQQRQESLERRTSATGPILPPGHPSSAASAPVS
CSGPPPPPPPPVPPPPTGATPPPPPPLPAGGAQGSSHDESSMSGLAAAIAGAKLRRVQRP
EDASGGSSPSGTSKSDANRASSGGGGGGLMEEMNKLLAKRRKAASQSDKPAEKKEDESQM
EDPSTSPSPGTRAASQPPNSSEAGRKPWERSNSVEKPVSSILSRTPSVAKSPEAKSPLQS
QPHSRMKPAGSVNDMALDAFDLDRMKQEILEEVVRELHKVKEEIIDAIRQELSGISTT
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggccacaagtgaacagagtatctgccaagcccgggcttccgtgatggtctacgatgac
accagtaagaaatgggtaccaatcaaacctggccagcagggattcagccggatcaacatc
taccacaacactgccagcaacaccttcagagtcgttggagtcaagttgcaggatcagcag
gttgtgatcaattattcaatcgtgaaagggctgaagtacaatcaggccacgccaaccttc
caccagtggcgagatgcccgccaggtctacggcttaaactttgcaagtaaagaagaggca
accacgttctccaatgcaatgctgtttgccctgaacatcatgaattcccaagaaggaggc
ccctccagccagcgtcaggtgcagaatggcccctctcctgatgagatggacatccagaga
agacaagtgatggagcagcaccagcagcagcgtcaggaatctctagaaagaagaacctcg
gccacagggcccatcctcccaccaggacatccttcatctgcagccagcgcccccgtctca
tgtagtgggcctccaccgccccccccacccccagtcccacctccacccactggggctacc
ccacctcccccacccccactgccagccggaggagcccaggggtccagccacgacgagagc
tccatgtcaggactggccgctgccatagctggggccaagctgagaagagtccaacggcca
gaagacgcatctggaggctccagtcccagtgggacctcaaagtccgatgccaaccgggca
agcagcgggggtggcggaggaggcctcatggaggaaatgaacaaactgctggccaagagg
agaaaagcagcctcccagtcagacaagccagccgagaagaaggaagatgaaagccaaatg
gaagatcctagtacctccccctctccggggacccgagcagccagccagccacctaactcc
tcagaggctggccggaagccctgggagcggagcaactcggtggagaagcctgtgtcctcg
attctgtccagaaccccgtctgtggcaaagagccccgaagctaagagcccccttcagtcg
cagcctcactctaggatgaagcctgctgggagcgtgaatgacatggccctggatgccttc
gacttggaccggatgaagcaggagatcctagaggaggtggtgagagagctccacaaggtg
aaggaggagatcatcgacgccatcaggcaggagctgagtgggatcagcaccacgtaa

DBGET integrated database retrieval system