KEGG   Homo sapiens (human): 51477Help
Entry
51477             CDS       T01001                                 

Gene name
ISYNA1, INO1, INOS, IPS, IPS_1, IPS-1
Definition
(RefSeq) inositol-3-phosphate synthase 1 (EC:5.5.1.4)
  KO
K01858  
myo-inositol-1-phosphate synthase [EC:5.5.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    51477 (ISYNA1)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.5  Intramolecular lyases
   5.5.1  Intramolecular lyases (only sub-subclass identified to date)
    5.5.1.4  inositol-3-phosphate synthase
     51477 (ISYNA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.11
AA seq 558 aa AA seqDB search
MEAAAQFFVESPDVVYGPEAIEAQYEYRTTRVSREGGVLKVHPTSTRFTFRTARQVPRLG
VMLVGWGGNNGSTLTAAVLANRLRLSWPTRSGRKEANYYGSLTQAGTVSLGLDAEGQEVF
VPFSAVLPMVAPNDLVFDGWDISSLNLAEAMRRAKVLDWGLQEQLWPHMEALRPRPSVYI
PEFIAANQSARADNLIPGSRAQQLEQIRRDIRDFRSSAGLDKVIVLWTANTERFCEVIPG
LNDTAENLLRTIELGLEVSPSTLFAVASILEGCAFLNGSPQNTLVPGALELAWQHRVFVG
GDDFKSGQTKVKSVLVDFLIGSGLKTMSIVSYNHLGNNDGENLSAPLQFRSKEVSKSNVV
DDMVQSNPVLYTPGEEPDHCVVIKYVPYVGDSKRALDEYTSELMLGGTNTLVLHNTCEDS
LLAAPIMLDLALLTELCQRVSFCTDMDPEPQTFHPVLSLLSFLFKAPLVPPGSPVVNALF
RQRSCIENILRACVGLPPQNHMLLEHKMERPGPSLKRVGPVAATYPMLNKKGPVPAATNG
CTGDANGHLQEEPPMPTT
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggaggccgccgcccagttcttcgtcgagagcccggacgtggtctacggccccgaggcc
atcgaggcgcaatacgagtaccggacgacgcgcgtcagccgcgagggtggcgttctcaag
gtgcaccccacgtccacgcgcttcaccttccggaccgcccggcaggtgccccggctcggg
gtcatgcttgtcggctggggcgggaacaacggctccacactcaccgccgcggtgctggcc
aatcgactgcgtttgtcctggcccacgcgcagcggccgcaaggaggccaactactacggc
tcgctgactcaggcgggcaccgtgagcctgggcctggacgccgagggccaggaggtgttc
gtacccttcagcgcggtgctgcccatggtggcgcccaacgacctcgtgttcgatggctgg
gacatctcgtcgctgaacctggccgaggcgatgcggcgcgcgaaggtgctggactggggg
ctgcaggagcaactgtggccgcacatggaggccctgcggccccggccttctgtttacatc
cccgaattcatcgcggccaaccagagcgcgcgcgcggacaacctcatcccaggctcgcgt
gcgcagcagctggagcagatccgcagggacatccgagacttccggtctagcgcggggctg
gacaaagtcatagtgctgtggacggcgaacacggagcgcttctgtgaggtgattccaggc
ctcaacgacacagccgagaacctgctgcgcaccattgagctcggtctggaggtgtcgccc
tccacgctcttcgccgtggccagcatcctggagggctgtgccttcctcaatgggtctccg
cagaacaccctggtgcccggagctcttgagctcgcgtggcagcaccgggtttttgtgggc
ggagatgacttcaagtcaggccagaccaaagtcaagtccgtgcttgtggacttcctcatt
ggctccggcctcaagaccatgtccatcgtgagttacaaccacctgggcaacaacgatggg
gagaacctatcggcgccattgcagttccgctctaaggaggtgtccaagagcaacgtggtg
gacgacatggtgcagagcaacccagtgctctatacgcccggcgaagagcctgaccactgc
gtggtcatcaagtatgtgccgtacgtgggtgacagcaagcgcgcgctggatgagtatacc
tcggagctgatgctgggcggaaccaacacactggtgctgcacaacacgtgtgaggactcg
ctgctggccgcacccatcatgctggacctagcgctgctgaccgagctgtgccagcgcgtg
agcttctgcactgacatggaccccgagccgcagaccttccaccccgtgctgtccctgctc
agcttcctcttcaaggcgccactagtgccgcccggcagcccggtggtcaatgcgcttttc
cgccagcgcagctgcatcgagaacatcctcagggcctgcgtggggctcccgccacagaac
cacatgctcctggaacacaaaatggagcgcccagggcccagcctcaagcgagttggaccc
gtggctgccacctaccctatgttgaacaagaaaggaccggtacccgctgccaccaatggc
tgcaccggtgatgccaatgggcatctgcaagaggagcccccaatgcccaccacctga

DBGET integrated database retrieval system