KEGG   Homo sapiens (human): 51477Help
Entry
51477             CDS       T01001                                 

Gene name
ISYNA1, INO1, INOS, IPS, IPS_1, IPS-1
Definition
inositol-3-phosphate synthase 1 (EC:5.5.1.4)
Orthology
K01858  
myo-inositol-1-phosphate synthase [EC:5.5.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:hsa00562]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.11
AA seq 504 aa AA seqDB search
MEAAAQFFVESPDVVYGPEAIEAQYEYRTTRVSREGGVLKEANYYGSLTQAGTVSLGLDA
EGQEVFVPFSAVLPMVAPNDLVFDGWDISSLNLAEAMRRAKVLDWGLQEQLWPHMEALRP
RPSVYIPEFIAANQSARADNLIPGSRAQQLEQIRRDIRDFRSSAGLDKVIVLWTANTERF
CEVIPGLNDTAENLLRTIELGLEVSPSTLFAVASILEGCAFLNGSPQNTLVPGALELAWQ
HRVFVGGDDFKSGQTKVKSVLVDFLIGSGLKTMSIVSYNHLGNNDGENLSAPLQFRSKEV
SKSNVVDDMVQSNPVLYTPGEEPDHCVVIKYVPYVGDSKRALDEYTSELMLGGTNTLVLH
NTCEDSLLAAPIMLDLALLTELCQRVSFCTDMDPEPQTFHPVLSLLSFLFKAPLVPPGSP
VVNALFRQRSCIENILRACVGLPPQNHMLLEHKMERPGPSLKRVGPVAATYPMLNKKGPV
PAATNGCTGDANGHLQEEPPMPTT
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggaggccgccgcccagttcttcgtcgagagcccggacgtggtctacggccccgaggcc
atcgaggcgcaatacgagtaccggacgacgcgcgtcagccgcgagggtggcgttctcaag
gaggccaactactacggctcgctgactcaggcgggcaccgtgagcctgggcctggacgcc
gagggccaggaggtgttcgtacccttcagcgcggtgctgcccatggtggcgcccaacgac
ctcgtgttcgatggctgggacatctcgtcgctgaacctggccgaggcgatgcggcgcgcg
aaggtgctggactgggggctgcaggagcaactgtggccgcacatggaggccctgcggccc
cggccttctgtttacatccccgaattcatcgcggccaaccagagcgcgcgcgcggacaac
ctcatcccaggctcgcgtgcgcagcagctggagcagatccgcagggacatccgagacttc
cggtctagcgcggggctggacaaagtcatagtgctgtggacggcgaacacggagcgcttc
tgtgaggtgattccaggcctcaacgacacagccgagaacctgctgcgcaccattgagctc
ggtctggaggtgtcgccctccacgctcttcgccgtggccagcatcctggagggctgtgcc
ttcctcaatgggtctccgcagaacaccctggtgcccggagctcttgagctcgcgtggcag
caccgggtttttgtgggcggagatgacttcaagtcaggccagaccaaagtcaagtccgtg
cttgtggacttcctcattggctccggcctcaagaccatgtccatcgtgagttacaaccac
ctgggcaacaacgatggggagaacctatcggcgccattgcagttccgctctaaggaggtg
tccaagagcaacgtggtggacgacatggtgcagagcaacccagtgctctatacgcccggc
gaagagcctgaccactgcgtggtcatcaagtatgtgccgtacgtgggtgacagcaagcgc
gcgctggatgagtatacctcggagctgatgctgggcggaaccaacacactggtgctgcac
aacacgtgtgaggactcgctgctggccgcacccatcatgctggacctagcgctgctgacc
gagctgtgccagcgcgtgagcttctgcactgacatggaccccgagccgcagaccttccac
cccgtgctgtccctgctcagcttcctcttcaaggcgccactagtgccgcccggcagcccg
gtggtcaatgcgcttttccgccagcgcagctgcatcgagaacatcctcagggcctgcgtg
gggctcccgccacagaaccacatgctcctggaacacaaaatggagcgcccagggcccagc
ctcaagcgagttggacccgtggctgccacctaccctatgttgaacaagaaaggaccggta
cccgctgccaccaatggctgcaccggtgatgccaatgggcatctgcaagaggagccccca
atgcccaccacctga

DBGET integrated database retrieval system