KEGG   Homo sapiens (human): 51478Help
Entry
51478             CDS       T01001                                 

Gene name
HSD17B7, PRAP, SDR37C1
Definition
hydroxysteroid (17-beta) dehydrogenase 7 (EC:1.1.1.62 1.1.1.270)
Orthology
K13373  
17beta-estradiol 17-dehydrogenase / 3beta-hydroxysteroid 3-dehydrogenase [EC:1.1.1.62 1.1.1.270]
Organism
hsa  Homo sapiens (human)
Pathway
Steroid biosynthesis
Steroid hormone biosynthesis
Metabolic pathways
Ovarian steroidogenesis
Module
Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    51478 (HSD17B7)
   00140 Steroid hormone biosynthesis
    51478 (HSD17B7)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    51478 (HSD17B7)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     51478 (HSD17B7)
    1.1.1.270  3beta-hydroxysteroid 3-dehydrogenase
     51478 (HSD17B7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
1q23
AA seq 341 aa AA seqDB search
MRKVVLITGASSGIGLALCKRLLAEDDELHLCLACRNMSKAEAVCAALLASHPTAEVTIV
QVDVSNLQSVFRASKELKQRFQRLDCIYLNAGIMPNPQLNIKALFFGLFSRKVIHMFSTA
EGLLTQGDKITADGLQEVFETNVFGHFILIRELEPLLCHSDNPSQLIWTSSRSARKSNFS
LEDFQHSKGKEPYSSSKYATDLLSVALNRNFNQQGLYSNVACPGTALTNLTYGILPPFIW
TLLMPAILLLRFFANAFTLTPYNGTEALVWLFHQKPESLNPLIKYLSATTGFGRNYIMTQ
KMDLDEDTAEKFYQKLLELEKHIRVTIQKTDNQARLSGSCL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaggtggttttgatcaccggggctagcagtggcattggcctggccctctgcaag
cggctgctggcggaagatgatgagcttcatctgtgtttggcgtgcaggaacatgagcaag
gcagaagctgtctgtgctgctctgctggcctctcaccccactgctgaggtcaccattgtc
caggtggatgtcagcaacctgcagtcggtcttccgggcctccaaggaacttaagcaaagg
tttcagagattagactgtatatatctaaatgctgggatcatgcctaatccacaactaaat
atcaaagcacttttctttggcctcttttcaagaaaagtgattcatatgttctccacagct
gaaggcctgctgacccagggtgataagatcactgctgatggacttcaggaggtgtttgag
accaatgtctttggccattttatcctgattcgggaactggagcctctcctctgtcacagt
gacaatccatctcagctcatctggacatcatctcgcagtgcaaggaaatctaatttcagc
ctcgaggacttccagcacagcaaaggcaaggaaccctacagctcttccaaatatgccact
gaccttttgagtgtggctttgaacaggaacttcaaccagcagggtctctattccaatgtg
gcctgtccaggtacagcattgaccaatttgacatatggaattctgcctccgtttatatgg
acgctgttgatgccggcaatattgctacttcgcttttttgcaaatgcattcactttgaca
ccatataatggaacagaagctctggtatggcttttccaccaaaagcctgaatctctcaat
cctctgatcaaatatctgagtgccaccactggctttggaagaaattacattatgacccag
aagatggacctagatgaagacactgctgaaaaattttatcaaaagttactggaactggaa
aagcacattagggtcactattcaaaaaacagataatcaggccaggctcagtggctcatgc
ctataa

DBGET integrated database retrieval system