KEGG   Homo sapiens (human): 51503Help
Entry
51503             CDS       T01001                                 

Gene name
CWC15, AD002, C11orf5, Cwf15, HSPC148, ORF5
Definition
(RefSeq) CWC15 spliceosome associated protein homolog
  KO
K12863  
protein CWC15
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Module
Spliceosome, Prp19/CDC5L complex
Spliceosome, 35S U5-snRNP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    51503 (CWC15)
Spliceosome [BR:hsa03041]
 Complex B
  Other components
   Prp19 complex
    51503 (CWC15)
 Complex C
   Prp19-CDC5 complex
    51503 (CWC15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9P013(Tdark)
UniProt: 
Structure
PDB: 

Jmol
Position
11q21
AA seq 229 aa AA seqDB search
MTTAARPTFEPARGGRGKGEGDLSQLSKQYSSRDLPSHTKIKYRQTTQDAPEEVRNRDFR
RELEERERAAAREKNRDRPTREHTTSSSVSKKPRLDQIPAANLDADDPLTDEEDEDFEEE
SDDDDTAALLAELEKIKKERAEEQARKEQEQKAEEERIRMENILSGNPLLNLTGPSQPQA
NFKVKRRWDDDVVFKNCAKGVDDQKKDKRFVNDTLRSEFHKKFMEKYIK
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgacaacagcagccaggccaacctttgaacctgccagaggtggaaggggaaaaggagaa
ggtgatttgagccaactttcaaagcagtattcaagcagagacctaccctctcatacaaag
ataaaatacagacagactactcaggatgcccctgaagaggttcgtaaccgtgacttcagg
agagagttggaagaaagagagagagctgctgcaagagagaaaaatagggatcgtccaacc
cgagaacatacaacctcctcttcagtgtcaaaaaagccacggttagaccagattcctgcc
gccaaccttgatgcagatgaccctctaacagatgaggaagatgaagattttgaagaagaa
agtgatgatgatgatactgcagctcttcttgcagaactggaaaaaattaaaaaagaaaga
gctgaagagcaggccaggaaggaacaagaacaaaaagctgaagaagagaggattcgtatg
gaaaacattctgagcggaaaccctctccttaatctcactggcccatcccagcctcaggcc
aacttcaaagttaaaagaaggtgggatgatgacgttgtcttcaagaactgtgcaaaaggt
gtagatgaccagaagaaagacaaaagatttgtaaatgacacactgcgatctgaatttcac
aaaaagttcatggagaaatatattaaatag

DBGET integrated database retrieval system