KEGG   Homo sapiens (human): 51503Help
Entry
51503             CDS       T01001                                 

Gene name
CWC15, C11orf5, Cwf15, HSPC148, ORF5
Definition
CWC15 spliceosome-associated protein homolog (S. cerevisiae)
Orthology
K12863  
protein CWC15
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Module
Spliceosome, Prp19/CDC5L complex
Spliceosome, 35S U5-snRNP
Class
Genetic Information Processing; Transcription; Spliceosome [PATH:hsa03040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
11q21
AA seq 229 aa AA seqDB search
MTTAARPTFEPARGGRGKGEGDLSQLSKQYSSRDLPSHTKIKYRQTTQDAPEEVRNRDFR
RELEERERAAAREKNRDRPTREHTTSSSVSKKPRLDQIPAANLDADDPLTDEEDEDFEEE
SDDDDTAALLAELEKIKKERAEEQARKEQEQKAEEERIRMENILSGNPLLNLTGPSQPQA
NFKVKRRWDDDVVFKNCAKGVDDQKKDKRFVNDTLRSEFHKKFMEKYIK
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgacaacagcagccaggccaacctttgaacctgccagaggtggaaggggaaaaggagaa
ggtgatttgagccaactttcaaagcagtattcaagcagagacctaccctctcatacaaag
ataaaatacagacagactactcaggatgcccctgaagaggttcgtaaccgtgacttcagg
agagagttggaagaaagagagagagctgctgcaagagagaaaaatagggatcgtccaacc
cgagaacatacaacctcctcttcagtgtcaaaaaagccacggttagaccagattcctgcc
gccaaccttgatgcagatgaccctctaacagatgaggaagatgaagattttgaagaagaa
agtgatgatgatgatactgcagctcttcttgcagaactggaaaaaattaaaaaagaaaga
gctgaagagcaggccaggaaggaacaagaacaaaaagctgaagaagagaggattcgtatg
gaaaacattctgagcggaaaccctctccttaatctcactggcccatcccagcctcaggcc
aacttcaaagttaaaagaaggtgggatgatgacgttgtcttcaagaactgtgcaaaaggt
gtagatgaccagaagaaagacaaaagatttgtaaatgacacactgcgatctgaatttcac
aaaaagttcatggagaaatatattaaatag

DBGET integrated database retrieval system