KEGG   Homo sapiens (human): 51512Help
Entry
51512             CDS       T01001                                 

Gene name
GTSE1, B99
Definition
G-2 and S-phase expressed 1
Orthology
K10129  
G-2 and S-phase expressed protein 1
Organism
hsa  Homo sapiens (human)
Pathway
p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04115 p53 signaling pathway
    51512 (GTSE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q13.2-q13.3
AA seq 739 aa AA seqDB search
MEGGGGRDEPSACRAGDVNMDDPKKEDILLLADEKFDFDLSLSSSSANEDDEVFFGPFGH
KERCIAASLELNNPVPEQPPLPTSESPFAWSPLAGEKFVEVYKEAHLLALHIESSSRNQA
AQAAKPEDPRSQGVERFIQESKLKINLFEKEKEMKKSPTSLKRETYYLSDSPLLGPPVGE
PRLLASSPALPSSGAQARLTRAPGPPHSAHALPRESCTAHAASQAATQRKPGTKLLLPRA
ASVRGRSIPGAAEKPKKEIPASPSRTKIPAEKESHRDVLPDKPAPGAVNVPAAGSHLGQG
KRAIPVPNKLGLKKTLLKAPGSTSNLARKSSSGPVWSGASSACTSPAVGKAKSSEFASIP
ANSSRPLSNISKSGRMGPAMLRPALPAGPVGASSWQAKRVDVSELAAEQLTAPPSASPTQ
PQTPEGGGQWLNSSCAWSESSQLNKTRSIRRRDSCLNSKTKVMPTPTNQFKIPKFSIGDS
PDSSTPKLSRAQRPQSCTSVGRVTVHSTPVRRSSGPAPQSLLSARRVSALPTPASRRCSG
LPPMTPKTMPRAVGSPLCVPARRRSSEPRKNSAMRTEPTRESNRKTDSRLVDVSPDRGSP
PSRVPQALNFSPEESDSTFSKSTATEVAREEAKPGGDAAPSEALLVDIKLEPLAVTPDAA
SQPLIDLPLIDFCDTPEAHVAVGSESRPLIDLMTNTPDMNKNVAKPSPVVGQLIDLSSPL
IQLSPEADKENVDSPLLKF
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaggcggcggccgcgatgagccttcagcctgccgggcaggggacgtgaacatg
gatgaccctaagaaggaagacattcttcttttggccgatgaaaaatttgacttcgatctt
tcattgtcttcttcgagtgcaaatgaagatgatgaagtcttcttcggaccctttggacat
aaagaaagatgtattgctgccagcttggaattaaataatccggttcccgaacagcctccg
ttgcccacatctgagagtccctttgcctggagccctctggccggggagaagttcgtggag
gtgtacaaagaagctcacttactggctttacacattgagagcagcagccggaaccaggca
gcccaagctgccaagcctgaagaccctcggagccagggcgtggaaagattcatacaggag
tcaaaattaaaaataaacctctttgagaaagaaaaggaaatgaagaaaagccccacgtct
cttaaaagggagacatactacctgtcagacagccccttgctggggccccctgtgggtgag
cctcggctcttggcctcctccccggccctgcccagctctggtgcccaggcccgcctcacc
cgggcgccggggcctccgcactctgctcatgctttgcccagggaatcatgcactgctcat
gctgcaagtcaggcagcgactcagaggaagcccgggaccaaattgctgctgcctcgagcg
gcctctgttagaggaagaagcatccctggggctgcggagaagcccaagaaagagattcca
gctagtccttccaggacaaaaatcccagctgagaaggaatcccaccgggatgttctccct
gacaaacctgccccgggtgctgtcaatgtgccggccgccggaagccacttgggccagggc
aagcgggcgatccctgttccaaacaagttggggctgaagaagaccctgttaaaagcaccc
ggctctaccagcaatctcgcaaggaagtcctcctcggggcctgtttggagcggggcatcc
agtgcgtgcacatccccagcagtgggcaaagctaaatcaagtgaatttgcaagtattcct
gcaaatagctcccggcctctgtcaaacatcagcaagtcaggcagaatgggacccgccatg
ctgcggccagctctgcctgcaggccctgtgggggcatcctcctggcaggccaagcgggtc
gatgtttctgagctggcagcggagcagctcacggcacccccctcagcatcccccacccaa
ccccagactccggaaggtggcggccagtggctgaactccagttgcgcttggtcagaatct
tctcaattgaataagactagaagtatcagacggcgagattcctgtctaaattccaagaca
aaggttatgcctactcctacaaatcaatttaaaattcctaagttttctattggtgactcc
ccggacagctcaacaccaaagctttcgcgggcacagcggccgcagtcgtgcacgtcagtt
ggcagggtcactgtccacagcaccccggttagacgctcatctgggccagcaccacaaagc
ctgctgagcgcacggcgtgtgtcagccttgcccacacccgccagccggcgctgctctggc
cttccaccgatgacccccaaaacgatgcccagggccgtgggctctcccctgtgtgtgcca
gctcggagacgttcctctgagccccgcaagaactctgcaatgagaactgaaccaacaagg
gagagcaacagaaagacagattccaggctggtggatgtgtcccctgacaggggttctcct
ccttcccgtgtgcctcaggcacttaacttttctccagaggaaagcgattctactttctcc
aaaagtactgccacagaagtagctcgggaggaagccaagccgggtggagatgcagcccct
agtgaggctcttcttgtagatatcaaactggaaccactcgcggtcactccagatgctgca
agccagcccctcattgaccttcctctcatcgacttctgcgataccccagaagcacacgtg
gctgtaggatctgaaagcaggcctctgatcgacctcatgacaaacactccagacatgaat
aaaaatgtggccaaaccttcaccggtggtgggacagctcatagacctgagctcccctctg
atccagctgagccctgaggctgacaaggagaacgtggattccccactcctcaagttctaa

DBGET integrated database retrieval system