KEGG   Homo sapiens (human): 5152Help
Entry
5152              CDS       T01001                                 

Gene name
PDE9A, HSPDE9A2
Definition
(RefSeq) phosphodiesterase 9A
  KO
K13761  
high affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9 [EC:3.1.4.35]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    5152 (PDE9A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.35  3',5'-cyclic-GMP phosphodiesterase
     5152 (PDE9A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O76083(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
21q22.3
AA seq 593 aa AA seqDB search
MGSGSSSYRPKAIYLDIDGRIQKVIFSKYCNSSDIMDLFCIATGLPRNTTISLLTTDDAM
VSIDPTMPANSERTPYKVRPVAIKQLSAGVEDKRTTSRGQSAERPLRDRRVVGLEQPRRE
GAFESGQVEPRPREPQGCYQEGQRIPPEREELIQSVLAQVAEQFSRAFKINELKAEVANH
LAVLEKRVELEGLKVVEIEKCKSDIKKMREELAARSSRTNCPCKYSFLDNHKKLTPRRDV
PTYPKYLLSPETIEALRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPVTLRRWLF
CVHDNYRNNPFHNFRHCFCVAQMMYSMVWLCSLQEKFSQTDILILMTAAICHDLDHPGYN
NTYQINARTELAVRYNDISPLENHHCAVAFQILAEPECNIFSNIPPDGFKQIRQGMITLI
LATDMARHAEIMDSFKEKMENFDYSNEEHMTLLKMILIKCCDISNEVRPMEVAEPWVDCL
LEEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPMVEEIML
QPLWESRDRYEELKRIDDAMKELQKKTDSLTSGATEKSRERSRDVKNSEGDCA
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgggatccggctcctccagctaccggcccaaggccatctacctggacatcgatggacgc
attcagaaggtaatcttcagcaagtactgcaactccagcgacatcatggacctgttctgc
atcgccaccggcctgcctcggaacacgaccatctccctgctgaccaccgacgacgccatg
gtctccatcgaccccaccatgcccgcgaattcagaacgcactccgtacaaagtgagacct
gtggccatcaagcaactctccgctggtgtcgaggacaagagaaccacaagccgtggccag
tctgctgagagaccactgagggacagacgggttgtgggcctggagcagccccggagggaa
ggagcatttgaaagtggacaggtagagcccaggcccagagagccccagggctgctaccag
gaaggccagcgcatccctccagagagagaagaattaatccagagcgtgctggcgcaggtt
gcagagcagttctcaagagcattcaaaatcaatgaactgaaagctgaagttgcaaatcac
ttggctgtcctagagaaacgcgtggaattggaaggactaaaagtggtggagattgagaaa
tgcaagagtgacattaagaagatgagggaggagctggcggccagaagcagcaggaccaac
tgcccctgtaagtacagttttttggataaccacaagaagttgactcctcgacgcgatgtt
cccacttaccccaagtacctgctctctccagagaccatcgaggccctgcggaagccgacc
tttgacgtctggctttgggagcccaatgagatgctgagctgcctggagcacatgtaccac
gacctcgggctggtcagggacttcagcatcaaccctgtcaccctcaggaggtggctgttc
tgcgtccacgacaactacagaaacaaccccttccacaacttccggcactgcttctgcgtg
gcccagatgatgtacagcatggtctggctctgcagtctccaggagaagttctcacaaacg
gatatcctgatcctaatgacagcggccatctgccacgatctggaccatcccggctacaac
aacacgtaccagatcaatgcccgcacagagctggcggtccgctacaatgacatctcaccg
ctggagaaccaccactgcgccgtggccttccagatcctcgccgagcctgagtgcaacatc
ttctccaacatcccacctgatgggttcaagcagatccgacagggaatgatcacattaatc
ttggccactgacatggcaagacatgcagaaattatggattctttcaaagagaaaatggag
aattttgactacagcaacgaggagcacatgaccctgctgaagatgattttgataaaatgc
tgtgatatctctaacgaggtccgtccaatggaagtcgcagagccttgggtggactgttta
ttagaggaatattttatgcagagcgaccgtgagaagtcagaaggccttcctgtggcaccg
ttcatggaccgagacaaagtgaccaaggccacagcccagattgggttcatcaagtttgtc
ctgatcccaatgtttgaaacagtgaccaagctcttccccatggttgaggagatcatgctg
cagccactttgggaatcccgagatcgctacgaggagctgaagcggatagatgacgccatg
aaagagttacagaagaagactgacagcttgacgtctggggccaccgagaagtccagagag
agaagcagagatgtgaaaaacagtgaaggagactgtgcctga

DBGET integrated database retrieval system