KEGG   Homo sapiens (human): 51529Help
Entry
51529             CDS       T01001                                 

Gene name
ANAPC11, APC11, Apc11p, HSPC214
Definition
(RefSeq) anaphase promoting complex subunit 11
  KO
K03358  anaphase-promoting complex subunit 11
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04120  Ubiquitin mediated proteolysis
hsa04914  Progesterone-mediated oocyte maturation
hsa05166  HTLV-I infection
Module
hsa_M00389  APC/C complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    51529 (ANAPC11)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    51529 (ANAPC11)
   04114 Oocyte meiosis
    51529 (ANAPC11)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    51529 (ANAPC11)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    51529 (ANAPC11)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Ring finger protein
     51529 (ANAPC11)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    51529 (ANAPC11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-ANAPC11 zf-rbx1 zf-RING_2 zf-RING_UBOX
Motif
Other DBs
NCBI-GeneID: 51529
NCBI-ProteinID: NP_001002245
OMIM: 614534
HGNC: 14452
Ensembl: ENSG00000141552
Vega: OTTHUMG00000177982
Pharos: Q9NYG5(Tbio)
UniProt: Q9NYG5
Structure
PDB: 

Jmol
Position
17q25.3
AA seq 84 aa AA seqDB search
MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCI
LKWLHAQQVQQHCPMCRQEWKFKE
NT seq 255 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgaagattaagtgctggaacggcgtggccacttggctctgggtggccaacgat
gagaactgtggcatctgcaggatggcatttaacggatgctgccctgactgcaaggtgccc
ggcgacgactgcccgctggtgtggggccagtgctcccactgcttccacatgcattgcatc
ctcaagtggctgcacgcacagcaggtgcagcagcactgccccatgtgccgccaggaatgg
aagttcaaggagtga

DBGET integrated database retrieval system