KEGG   Homo sapiens (human): 51529Help
Entry
51529             CDS       T01001                                 

Gene name
ANAPC11, APC11, Apc11p
Definition
anaphase promoting complex subunit 11
Orthology
K03358  
anaphase-promoting complex subunit 11
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
HTLV-I infection
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    51529 (ANAPC11)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    51529 (ANAPC11)
   04114 Oocyte meiosis
    51529 (ANAPC11)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    51529 (ANAPC11)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    51529 (ANAPC11)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    Ring finger protein
     51529 (ANAPC11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q25.3
AA seq 196 aa AA seqDB search
MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCPLHGESISRCLGWCPQPVPVLGG
RAHPQVPINTASPTPGQHTGSLMSREESSRSPDPTPPALDQETSSLLRCTSPWCLDHSCD
LFGITDQVSADGPRACRQGARRRLPAGVGPVLPLLPHALHPQVAARTAGAAALPHVPPGM
EVQGVRPDLALAGGAS
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgaagattaagtgctggaacggcgtggccacttggctctgggtggccaacgat
gagaactgtggcatctgcaggatggcatttaacggatgctgccctgactgtcctctccat
ggagaaagcatttctaggtgtttgggctggtgcccgcagcctgtgcctgtcctgggaggc
agggcccatccacaggtgcccatcaacacagcttccccaacgcctgggcagcacaccgga
tccctgatgtctagggaagagtcttctaggtccccagaccccacccctcctgcccttgat
caagagaccagttcactactcagatgcacgtctccttggtgccttgaccattcatgtgac
ctttttggcatcacagatcaagtgtctgcagatgggcccagggcctgtaggcaaggtgcc
cggcgacgactgcccgctggtgtggggccagtgctcccactgcttccacatgcattgcat
cctcaagtggctgcacgcacagcaggtgcagcagcactgccccatgtgccgccaggaatg
gaagttcaaggagtgaggcccgacctggctctcgctggaggggcatcctga

DBGET integrated database retrieval system