KEGG   Homo sapiens (human): 51548Help
Entry
51548             CDS       T01001                                 

Gene name
SIRT6, SIR2L6
Definition
(RefSeq) sirtuin 6 (EC:2.4.2.31)
  KO
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
hsa  Homo sapiens (human)
Pathway
Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    51548 (SIRT6)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     51548 (SIRT6)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    SIRTs (sirtuins, class III HDACs)
     51548 (SIRT6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.3
AA seq 355 aa AA seqDB search
MSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTASG
IPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHV
RSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRACRGE
LRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVN
LQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPRVLERALPPLPRPPTPKLEPK
EESPTRINGSIPAGPKQEPCAQHNGSEPASPKRERPTSPAPHRPPKRVKAKAVPS
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgaattacgcggcggggctgtcgccgtacgcggacaagggcaagtgcggcctc
ccggagatcttcgaccccccggaggagctggagcggaaggtgtgggaactggcgaggctg
gtctggcagtcttccagtgtggtgttccacacgggtgccggcatcagcactgcctctggc
atccccgacttcaggggtccccacggagtctggaccatggaggagcgaggtctggccccc
aagttcgacaccacctttgagagcgcgcggcccacgcagacccacatggcgctggtgcag
ctggagcgcgtgggcctcctccgcttcctggtcagccagaacgtggacgggctccatgtg
cgctcaggcttccccagggacaaactggcagagctccacgggaacatgtttgtggaagaa
tgtgccaagtgtaagacgcagtacgtccgagacacagtcgtgggcaccatgggcctgaag
gccacgggccggctctgcaccgtggctaaggcaagggggctgcgagcctgcaggggagag
ctgagggacaccatcctagactgggaggactccctgcccgaccgggacctggcactcgcc
gatgaggccagcaggaacgccgacctgtccatcacgctgggtacatcgctgcagatccgg
cccagcgggaacctgccgctggctaccaagcgccggggaggccgcctggtcatcgtcaac
ctgcagcccaccaagcacgaccgccatgctgacctccgcatccatggctacgttgacgag
gtcatgacccggctcatgaagcacctggggctggagatccccgcctgggacggcccccgt
gtgctggagagggcgctgccacccctgccccgcccgcccacccccaagctggagcccaag
gaggaatctcccacccggatcaacggctctatccccgccggccccaagcaggagccctgc
gcccagcacaacggctcagagcccgccagccccaaacgggagcggcccaccagccctgcc
ccccacagaccccccaaaagggtgaaggccaaggcggtccccagctga

DBGET integrated database retrieval system