KEGG   Homo sapiens (human): 51548Help
Entry
51548             CDS       T01001                                 

Gene name
SIRT6, SIR2L6
Definition
sirtuin 6 (EC:2.4.2.31)
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     51548 (SIRT6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.3
AA seq 328 aa AA seqDB search
MSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTASG
IPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHV
RSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRACRNA
DLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMK
HLGLEIPAWDGPRVLERALPPLPRPPTPKLEPKEESPTRINGSIPAGPKQEPCAQHNGSE
PASPKRERPTSPAPHRPPKRVKAKAVPS
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgaattacgcggcggggctgtcgccgtacgcggacaagggcaagtgcggcctc
ccggagatcttcgaccccccggaggagctggagcggaaggtgtgggaactggcgaggctg
gtctggcagtcttccagtgtggtgttccacacgggtgccggcatcagcactgcctctggc
atccccgacttcaggggtccccacggagtctggaccatggaggagcgaggtctggccccc
aagttcgacaccacctttgagagcgcgcggcccacgcagacccacatggcgctggtgcag
ctggagcgcgtgggcctcctccgcttcctggtcagccagaacgtggacgggctccatgtg
cgctcaggcttccccagggacaaactggcagagctccacgggaacatgtttgtggaagaa
tgtgccaagtgtaagacgcagtacgtccgagacacagtcgtgggcaccatgggcctgaag
gccacgggccggctctgcaccgtggctaaggcaagggggctgcgagcctgcaggaacgcc
gacctgtccatcacgctgggtacatcgctgcagatccggcccagcgggaacctgccgctg
gctaccaagcgccggggaggccgcctggtcatcgtcaacctgcagcccaccaagcacgac
cgccatgctgacctccgcatccatggctacgttgacgaggtcatgacccggctcatgaag
cacctggggctggagatccccgcctgggacggcccccgtgtgctggagagggcgctgcca
cccctgccccgcccgcccacccccaagctggagcccaaggaggaatctcccacccggatc
aacggctctatccccgccggccccaagcaggagccctgcgcccagcacaacggctcagag
cccgccagccccaaacgggagcggcccaccagccctgccccccacagaccccccaaaagg
gtgaaggccaaggcggtccccagctga

DBGET integrated database retrieval system