KEGG   Homo sapiens (human): 51555Help
Entry
51555             CDS       T01001                                 

Gene name
PEX5L, PEX5R, PEX5RP, PXR2, PXR2B, TRIP8b
Definition
(RefSeq) peroxisomal biogenesis factor 5-like
  KO
K13342  
peroxin-5
Organism
hsa  Homo sapiens (human)
Pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    51555 (PEX5L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q26.33
AA seq 626 aa AA seqDB search
MYQGHMQKSKEQGYGKLSSDEDLEIIVDQKQGKGSRAADKAVAMVMKEIPREESAEEKPL
LTMTSQLVNEQQESRPLLSPSIDDFLCETKSEAIARPVTSNTAVLTTGLDLLDLSEPVSQ
TQTKAKKSEPSSKTSSLKKKADGSDLISTDAEQRGQPLRVPETSSLDLDIQTQLEKWDDV
KFHGDRNTKGHPMAERKSSSSRTGSKELLWSSEHRSQPELSGGKSALNSESASELELVAP
TQARLTKEHRWGSALLSRNHSLEEEFERAKAAVESDTEFWDKMQAEWEEMARRNWISENQ
EAQNQVTISASEKGYYFHTENPFKDWPGAFEEGLKRLKEGDLPVTILFMEAAILQDPGDA
EAWQFLGITQAENENEQAAIVALQRCLELQPNNLKALMALAVSYTNTGHQQDACDALKNW
IKQNPKYKYLVKSKKGSPGLTRRMSKSPVDSSVLEGVKELYLEAAHQNGDMIDPDLQTGL
GVLFHLSGEFNRAIDAFNAALTVRPEDYSLWNRLGATLANGDRSEEAVEAYTRALEIQPG
FIRSRYNLGISCINLGAYREAVSNFLTALSLQRKSRNQQQVPHPAISGNIWAALRIALSL
MDQPELFQAANLGDLDVLLRAFNLDP
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgtaccagggacacatgcagaaaagtaaagaacaaggatatggaaaactaagcagtgat
gaagacctcgaaataattgttgatcaaaagcagggaaaaggctctagggcggcagataag
gctgttgccatggtgatgaaggagataccgagggaggagtctgctgaagaaaagcccctc
cttactatgacatcacagctggtgaatgagcaacaagaaagcagacccctcctgagtccc
tccatcgatgactttctctgtgaaaccaaatcggaagcaatagcaaggccagtaacatcc
aatacagctgtattgaccactggcttagatctcctcgacctgagtgaaccagtctctcaa
acccaaaccaaagccaagaagtcagagccctcatcaaaaacctcatccctcaagaaaaag
gccgatggatctgacctcatcagcacggatgctgagcagagaggccagcctctcagagtc
ccggagacttcatccttagatctagacattcaaacacaactggaaaaatgggacgatgtt
aagtttcatggagatcgaaataccaagggacatccaatggcagagagaaaatcatcctca
tctagaactggatcaaaagagctcttatggtcctcagaacacagatctcaaccagaactg
agtggtggaaaaagcgccctcaactctgagtcggcttcagaattggaattagtggctccg
actcaggctcgactgaccaaagaacatcgctggggaagcgcattactttctagaaaccac
tccttagaagaagagtttgaaagggcaaaagcagcagtggagtcagatacagagttttgg
gataagatgcaagcagaatgggaagaaatggctcggaggaactggatatctgagaaccaa
gaagcccagaaccaagtaaccatctcggctagtgagaagggatattactttcacactgaa
aaccccttcaaggactggcctggagcatttgaagaaggcttaaaaaggctgaaggaaggg
gatctgccagtcaccatcctgttcatggaagcagcaattcttcaggaccctggagatgca
gaggcatggcagttcctcgggataacccaggcggagaatgaaaatgaacaagcagctatt
gtcgccctccagaggtgcttagaattacagcccaacaacttaaaagctttgatggccttg
gctgtgagttatactaacactggccatcagcaggatgcctgtgacgctctgaagaattgg
attaagcaaaatccaaagtacaaataccttgtgaaaagcaagaagggatctccaggcctc
acccggcggatgtctaagtccccagttgatagctctgttctggaaggggtgaaggaatta
tatctggaagctgcccaccaaaatggagatatgatcgacccagacctgcagacaggtcta
ggggttctgttccacctgagtggagaatttaatagagcaatagatgcatttaacgctgcc
ttaactgttcggccagaggactattcactatggaaccgcctcggggcgaccttggcgaac
ggagaccgcagcgaggaagccgtggaggcctatacgcgagcactggagattcagccagga
ttcatccggtccagatacaacctaggaataagctgcatcaacctgggcgcctacagagaa
gcggtcagcaattttctcactgccctcagtttgcaaagaaagagcaggaatcagcagcaa
gttcctcatcctgcaatctctgggaatatctgggctgccctcagaattgcgctctctctg
atggaccaaccagaactcttccaggcggctaatcttggtgacctggatgtcctcttaaga
gctttcaacttggatccttga

DBGET integrated database retrieval system