KEGG   Homo sapiens (human): 51555Help
Entry
51555             CDS       T01001                                 

Gene name
PEX5L, PEX5R, PEX5RP, PXR2, PXR2B, TRIP8b
Definition
peroxisomal biogenesis factor 5-like
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q26.33
AA seq 624 aa AA seqDB search
MYQGHMQVVGVTLKKKWHCLQKSDLTLALGKGSRAADKAVAMVMKEIPREESAEEKPLLT
MTSQLVNEQQESRPLLSPSIDDFLCETKSEAIARPVTSNTAVLTTGLDLLDLSEPVSQTQ
TKAKKSEPSSKTSSLKKKADGSDLISTDAEQRGQPLRVPETSSLDLDIQTQLEKWDDVKF
HGDRNTKGHPMAERKSSSSRTGSKELLWSSEHRSQPELSGGKSALNSESASELELVAPTQ
ARLTKEHRWGSALLSRNHSLEEEFERAKAAVESDTEFWDKMQAEWEEMARRNWISENQEA
QNQVTISASEKGYYFHTENPFKDWPGAFEEGLKRLKEGDLPVTILFMEAAILQDPGDAEA
WQFLGITQAENENEQAAIVALQRCLELQPNNLKALMALAVSYTNTGHQQDACDALKNWIK
QNPKYKYLVKSKKGSPGLTRRMSKSPVDSSVLEGVKELYLEAAHQNGDMIDPDLQTGLGV
LFHLSGEFNRAIDAFNAALTVRPEDYSLWNRLGATLANGDRSEEAVEAYTRALEIQPGFI
RSRYNLGISCINLGAYREAVSNFLTALSLQRKSRNQQQVPHPAISGNIWAALRIALSLMD
QPELFQAANLGDLDVLLRAFNLDP
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgtaccagggacacatgcaggtagtaggtgtaaccttgaagaaaaagtggcactgtctt
caaaaaagtgacctgaccctggctttgggaaaaggctctagggcggcagataaggctgtt
gccatggtgatgaaggagataccgagggaggagtctgctgaagaaaagcccctccttact
atgacatcacagctggtgaatgagcaacaagaaagcagacccctcctgagtccctccatc
gatgactttctctgtgaaaccaaatcggaagcaatagcaaggccagtaacatccaataca
gctgtattgaccactggcttagatctcctcgacctgagtgaaccagtctctcaaacccaa
accaaagccaagaagtcagagccctcatcaaaaacctcatccctcaagaaaaaggccgat
ggatctgacctcatcagcacggatgctgagcagagaggccagcctctcagagtcccggag
acttcatccttagatctagacattcaaacacaactggaaaaatgggacgatgttaagttt
catggagatcgaaataccaagggacatccaatggcagagagaaaatcatcctcatctaga
actggatcaaaagagctcttatggtcctcagaacacagatctcaaccagaactgagtggt
ggaaaaagcgccctcaactctgagtcggcttcagaattggaattagtggctccgactcag
gctcgactgaccaaagaacatcgctggggaagcgcattactttctagaaaccactcctta
gaagaagagtttgaaagggcaaaagcagcagtggagtcagatacagagttttgggataag
atgcaagcagaatgggaagaaatggctcggaggaactggatatctgagaaccaagaagcc
cagaaccaagtaaccatctcggctagtgagaagggatattactttcacactgaaaacccc
ttcaaggactggcctggagcatttgaagaaggcttaaaaaggctgaaggaaggggatctg
ccagtcaccatcctgttcatggaagcagcaattcttcaggaccctggagatgcagaggca
tggcagttcctcgggataacccaggcggagaatgaaaatgaacaagcagctattgtcgcc
ctccagaggtgcttagaattacagcccaacaacttaaaagctttgatggccttggctgtg
agttatactaacactggccatcagcaggatgcctgtgacgctctgaagaattggattaag
caaaatccaaagtacaaataccttgtgaaaagcaagaagggatctccaggcctcacccgg
cggatgtctaagtccccagttgatagctctgttctggaaggggtgaaggaattatatctg
gaagctgcccaccaaaatggagatatgatcgacccagacctgcagacaggtctaggggtt
ctgttccacctgagtggagaatttaatagagcaatagatgcatttaacgctgccttaact
gttcggccagaggactattcactatggaaccgcctcggggcgaccttggcgaacggagac
cgcagcgaggaagccgtggaggcctatacgcgagcactggagattcagccaggattcatc
cggtccagatacaacctaggaataagctgcatcaacctgggcgcctacagagaagcggtc
agcaattttctcactgccctcagtttgcaaagaaagagcaggaatcagcagcaagttcct
catcctgcaatctctgggaatatctgggctgccctcagaattgcgctctctctgatggac
caaccagaactcttccaggcggctaatcttggtgacctggatgtcctcttaagagctttc
aacttggatccttga

  All links  
No link information was found.   
DBGET integrated database retrieval system