KEGG   Homo sapiens (human): 51561Help
Entry
51561             CDS       T01001                                 

Gene name
IL23A, IL-23, IL-23A, IL23P19, P19, SGRF
Definition
interleukin 23, alpha subunit p19
Orthology
K05426  
interleukin 23, alpha subunit p19
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
Pertussis
Tuberculosis
Inflammatory bowel disease (IBD)
Rheumatoid arthritis
Drug target
Ustekinumab: 
Briakinumab: 
Other: 
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:hsa04630]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Human Diseases; Immune diseases; Rheumatoid arthritis [PATH:hsa05323]
Human Diseases; Immune diseases; Inflammatiory bowel disease (IBD) [PATH:hsa05321]
Human Diseases; Infectious diseases; Pertussis [PATH:hsa05133]
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q13.3
AA seq 189 aa AA seqDB search
MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEG
DEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSP
VGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVF
AHGAATLSP
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgctggggagcagagctgtaatgctgctgttgctgctgccctggacagctcagggcaga
gctgtgcctgggggcagcagccctgcctggactcagtgccagcagctttcacagaagctc
tgcacactggcctggagtgcacatccactagtgggacacatggatctaagagaagaggga
gatgaagagactacaaatgatgttccccatatccagtgtggagatggctgtgacccccaa
ggactcagggacaacagtcagttctgcttgcaaaggatccaccagggtctgattttttat
gagaagctgctaggatcggatattttcacaggggagccttctctgctccctgatagccct
gtgggccagcttcatgcctccctactgggcctcagccaactcctgcagcctgagggtcac
cactgggagactcagcagattccaagcctcagtcccagccagccatggcagcgtctcctt
ctccgcttcaaaatccttcgcagcctccaggcctttgtggctgtagccgcccgggtcttt
gcccatggagcagcaaccctgagtccctaa

DBGET integrated database retrieval system