KEGG   Homo sapiens (human): 51561Help
Entry
51561             CDS       T01001                                 

Gene name
IL23A, IL-23, IL-23A, IL23P19, P19, SGRF
Definition
(RefSeq) interleukin 23 subunit alpha
  KO
K05426  interleukin 23 subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04625  C-type lectin receptor signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa04659  Th17 cell differentiation
hsa05133  Pertussis
hsa05152  Tuberculosis
hsa05200  Pathways in cancer
hsa05321  Inflammatory bowel disease (IBD)
hsa05323  Rheumatoid arthritis
Network
N00053  Cytokine-Jak-STAT signaling pathway
Drug target
Apilimod mesylate: D06556
Brazikumab: D10912
Briakinumab: D09588
Guselkumab: D10438
Risankizumab: D11052
Tildrakizumab: D10400
Ustekinumab: D09214
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    51561 (IL23A)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    51561 (IL23A)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    51561 (IL23A)
   04659 Th17 cell differentiation
    51561 (IL23A)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    51561 (IL23A)
  Immune diseases
   05323 Rheumatoid arthritis
    51561 (IL23A)
   05321 Inflammatiory bowel disease (IBD)
    51561 (IL23A)
  Infectious diseases
   05133 Pertussis
    51561 (IL23A)
   05152 Tuberculosis
    51561 (IL23A)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   51561 (IL23A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL23 IL6
Motif
Other DBs
NCBI-GeneID: 51561
NCBI-ProteinID: NP_057668
OMIM: 605580
HGNC: 15488
Ensembl: ENSG00000110944
Vega: OTTHUMG00000187402
Pharos: Q9NPF7(Tclin)
UniProt: Q9NPF7
Structure
PDB: 

Jmol
Position
12q13.3
AA seq 189 aa AA seqDB search
MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEG
DEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSP
VGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVF
AHGAATLSP
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgctggggagcagagctgtaatgctgctgttgctgctgccctggacagctcagggcaga
gctgtgcctgggggcagcagccctgcctggactcagtgccagcagctttcacagaagctc
tgcacactggcctggagtgcacatccactagtgggacacatggatctaagagaagaggga
gatgaagagactacaaatgatgttccccatatccagtgtggagatggctgtgacccccaa
ggactcagggacaacagtcagttctgcttgcaaaggatccaccagggtctgattttttat
gagaagctgctaggatcggatattttcacaggggagccttctctgctccctgatagccct
gtgggccagcttcatgcctccctactgggcctcagccaactcctgcagcctgagggtcac
cactgggagactcagcagattccaagcctcagtcccagccagccatggcagcgtctcctt
ctccgcttcaaaatccttcgcagcctccaggcctttgtggctgtagccgcccgggtcttt
gcccatggagcagcaaccctgagtccctaa

DBGET integrated database retrieval system