KEGG   Homo sapiens (human): 51561Help
Entry
51561             CDS       T01001                                 

Gene name
IL23A, IL-23, IL-23A, IL23P19, P19, SGRF
Definition
interleukin 23, alpha subunit p19
Orthology
K05426  
interleukin 23, alpha subunit p19
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
Pertussis
Tuberculosis
Inflammatory bowel disease (IBD)
Rheumatoid arthritis
Drug target
Ustekinumab: 
Briakinumab: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    51561 (IL23A)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    51561 (IL23A)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    51561 (IL23A)
   05321 Inflammatiory bowel disease (IBD)
    51561 (IL23A)
  Infectious diseases
   05133 Pertussis
    51561 (IL23A)
   05152 Tuberculosis
    51561 (IL23A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q13.3
AA seq 189 aa AA seqDB search
MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEG
DEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSP
VGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVF
AHGAATLSP
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgctggggagcagagctgtaatgctgctgttgctgctgccctggacagctcagggcaga
gctgtgcctgggggcagcagccctgcctggactcagtgccagcagctttcacagaagctc
tgcacactggcctggagtgcacatccactagtgggacacatggatctaagagaagaggga
gatgaagagactacaaatgatgttccccatatccagtgtggagatggctgtgacccccaa
ggactcagggacaacagtcagttctgcttgcaaaggatccaccagggtctgattttttat
gagaagctgctaggatcggatattttcacaggggagccttctctgctccctgatagccct
gtgggccagcttcatgcctccctactgggcctcagccaactcctgcagcctgagggtcac
cactgggagactcagcagattccaagcctcagtcccagccagccatggcagcgtctcctt
ctccgcttcaaaatccttcgcagcctccaggcctttgtggctgtagccgcccgggtcttt
gcccatggagcagcaaccctgagtccctaa

DBGET integrated database retrieval system