KEGG   Homo sapiens (human): 51562Help
Entry
51562             CDS       T01001                                 

Gene name
MBIP
Definition
(RefSeq) MAP3K12 binding inhibitory protein 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 51562
NCBI-ProteinID: NP_057670
OMIM: 609431
HGNC: 20427
Ensembl: ENSG00000151332
Vega: OTTHUMG00000140222
Pharos: Q9NS73(Tdark)
UniProt: Q9NS73 B2RCV0
Position
14q13.3
AA seq 344 aa AA seqDB search
MAAATELNRPSSGDRNLERRCRPNLSREVLYEIFRSLHTLVGQLDLRDDVVKITIDWNKL
QSLSAFQPALLFSALEQHILYLQPFLAKLQSPIKEENTTAVEEIGRTEMGNKNEVNDKFS
IGDLQEEEKHKESDLRDVKKTQIHFDPEVVQIKAGKAEIDRRISAFIERKQAEINENNVR
EFCNVIDCNQENSCARTDAIFTPYPGFKSHVKVSRVVNTYGPQTRPEGIPGSGHKPNSML
RDCGNQAVEERLQNIEAHLRLQTGGPVPRDIYQRIKKLEDKILELEGISPEYFQSVSFSG
KRRKVQPPQQNYSLAELDEKISALKQALLRKSREAESMATHHLP
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgccacggagcttaatcgcccgagcagcggtgacaggaacctggagcgaaga
tgcagacccaacctctcccgagaggtgctctacgaaatctttcgctccctacacaccctg
gttggacagcttgacctcagagatgatgtggtgaaaattacaatcgattggaacaagctc
cagagcctctcggcattccagcctgcattgctctttagtgcacttgaacaacacatttta
tatttacagccttttttagcaaaacttcagtctccgattaaagaggagaatacaactgct
gttgaagagataggaagaacagaaatggggaacaaaaatgaagtaaatgacaaattttcc
attggcgacctacaagaggaagaaaagcacaaagaaagtgatttaagagatgtgaaaaag
acacagatccattttgatccagaagtagttcagataaaggctggaaaagcagaaattgac
agacgaatatctgcatttattgaaagaaagcaagctgaaatcaatgaaaacaacgtcagg
gaattttgcaatgttattgattgtaatcaagaaaatagttgtgcaagaactgatgcgatt
tttaccccttaccccggatttaaaagtcacgtaaaagtttctagagttgtgaatacatac
ggaccacagactagacctgaaggaattccagggtcaggtcataaacctaacagcatgctt
cgagactgtggtaatcaggctgtagaagaacgactacaaaatattgaggcccacttgcgg
ttacagacaggtggtccagtgccaagagacatttatcagagaattaaaaaacttgaggat
aaaatccttgaattggaaggcatctctcctgaatattttcagtctgtaagcttttctgga
aaaagaagaaaagttcaaccacctcaacagaactattcactggctgaacttgatgagaaa
attagtgccctcaaacaagccctcctcagaaaatcaagagaagcagaatccatggcaacc
caccaccttccatga

DBGET integrated database retrieval system