KEGG   Homo sapiens (human): 51562Help
Entry
51562             CDS       T01001                                 

Gene name
MBIP
Definition
(RefSeq) MAP3K12 binding inhibitory protein 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q13.3
AA seq 344 aa AA seqDB search
MAAATELNRPSSGDRNLERRCRPNLSREVLYEIFRSLHTLVGQLDLRDDVVKITIDWNKL
QSLSAFQPALLFSALEQHILYLQPFLAKLQSPIKEENTTAVEEIGRTEMGNKNEVNDKFS
IGDLQEEEKHKESDLRDVKKTQIHFDPEVVQIKAGKAEIDRRISAFIERKQAEINENNVR
EFCNVIDCNQENSCARTDAIFTPYPGFKSHVKVSRVVNTYGPQTRPEGIPGSGHKPNSML
RDCGNQAVEERLQNIEAHLRLQTGGPVPRDIYQRIKKLEDKILELEGISPEYFQSVSFSG
KRRKVQPPQQNYSLAELDEKISALKQALLRKSREAESMATHHLP
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgccacggagcttaatcgcccgagcagcggtgacaggaacctggagcgaaga
tgcagacccaacctctcccgagaggtgctctacgaaatctttcgctccctacacaccctg
gttggacagcttgacctcagagatgatgtggtgaaaattacaatcgattggaacaagctc
cagagcctctcggcattccagcctgcattgctctttagtgcacttgaacaacacatttta
tatttacagccttttttagcaaaacttcagtctccgattaaagaggagaatacaactgct
gttgaagagataggaagaacagaaatggggaacaaaaatgaagtaaatgacaaattttcc
attggcgacctacaagaggaagaaaagcacaaagaaagtgatttaagagatgtgaaaaag
acacagatccattttgatccagaagtagttcagataaaggctggaaaagcagaaattgac
agacgaatatctgcatttattgaaagaaagcaagctgaaatcaatgaaaacaacgtcagg
gaattttgcaatgttattgattgtaatcaagaaaatagttgtgcaagaactgatgcgatt
tttaccccttaccccggatttaaaagtcacgtaaaagtttctagagttgtgaatacatac
ggaccacagactagacctgaaggaattccagggtcaggtcataaacctaacagcatgctt
cgagactgtggtaatcaggctgtagaagaacgactacaaaatattgaggcccacttgcgg
ttacagacaggtggtccagtgccaagagacatttatcagagaattaaaaaacttgaggat
aaaatccttgaattggaaggcatctctcctgaatattttcagtctgtaagcttttctgga
aaaagaagaaaagttcaaccacctcaacagaactattcactggctgaacttgatgagaaa
attagtgccctcaaacaagccctcctcagaaaatcaagagaagcagaatccatggcaacc
caccaccttccatga

DBGET integrated database retrieval system