KEGG   Homo sapiens (human): 5158Help
Entry
5158              CDS       T01001                                 

Gene name
PDE6B, CSNB3, CSNBAD2, PDEB, RP40, rd1
Definition
(RefSeq) phosphodiesterase 6B (EC:3.1.4.35)
  KO
K13756  
rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit beta [EC:3.1.4.35]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Phototransduction
Disease
H00527  
Retinitis pigmentosa (RP)
H00787  
Congenital stationary night blindness (CSNB)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    5158 (PDE6B)
 Organismal Systems
  Sensory system
   04744 Phototransduction
    5158 (PDE6B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.35  3',5'-cyclic-GMP phosphodiesterase
     5158 (PDE6B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4p16.3
AA seq 854 aa AA seqDB search
MSLSEEQARSFLDQNPDFARQYFGKKLSPENVAAACEDGCPPDCDSLRDLCQVEESTALL
ELVQDMQESINMERVVFKVLRRLCTLLQADRCSLFMYRQRNGVAELATRLFSVQPDSVLE
DCLVPPDSEIVFPLDIGVVGHVAQTKKMVNVEDVAECPHFSSFADELTDYKTKNMLATPI
MNGKDVVAVIMAVNKLNGPFFTSEDEDVFLKYLNFATLYLKIYHLSYLHNCETRRGQVLL
WSANKVFEELTDIERQFHKAFYTVRAYLNCERYSVGLLDMTKEKEFFDVWSVLMGESQPY
SGPRTPDGREIVFYKVIDYILHGKEEIKVIPTPSADHWALASGLPSYVAESGFICNIMNA
SADEMFKFQEGALDDSGWLIKNVLSMPIVNKKEEIVGVATFYNRKDGKPFDEQDEVLMES
LTQFLGWSVMNTDTYDKMNKLENRKDIAQDMVLYHVKCDRDEIQLILPTRARLGKEPADC
DEDELGEILKEELPGPTTFDIYEFHFSDLECTELDLVKCGIQMYYELGVVRKFQIPQEVL
VRFLFSISKGYRRITYHNWRHGFNVAQTMFTLLMTGKLKSYYTDLEAFAMVTAGLCHDID
HRGTNNLYQMKSQNPLAKLHGSSILERHHLEFGKFLLSEETLNIYQNLNRRQHEHVIHLM
DIAIIATDLALYFKKRAMFQKIVDESKNYQDKKSWVEYLSLETTRKEIVMAMMMTACDLS
AITKPWEVQSKVALLVAAEFWEQGDLERTVLDQQPIPMMDRNKAAELPKLQVGFIDFVCT
FVYKEFSRFHEEILPMFDRLQNNRKEWKALADEYEAKVKALEEKEEEERVAAKKVGTEIC
NGGPAPKSSTCCIL
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcagtgaggagcaggcccggagctttctggaccagaaccccgattttgcccgc
cagtactttgggaagaaactgagccctgagaatgtggccgcggcctgcgaggacgggtgc
ccgccggactgcgacagcctccgggacctctgccaggtggaggagagcacggcgctgctg
gagctggtgcaggatatgcaggagagcatcaacatggagcgcgtggtcttcaaggtcctg
cggcgcctctgcaccctcctgcaggccgaccgctgcagcctcttcatgtaccgccagcgc
aacggcgtggccgagctggccaccaggcttttcagcgtgcagccggacagcgtcctggag
gactgcctggtgccccccgactccgagatcgtcttcccactggacatcggggtcgtgggc
cacgtggctcagaccaaaaagatggtgaacgtcgaggacgtggccgagtgccctcacttc
agctcatttgctgacgagctcactgactacaagacaaagaatatgctggccacacccatc
atgaatggcaaagacgtcgtggcggtgatcatggcagtgaacaagctcaacggcccattc
ttcaccagcgaagacgaagatgtgttcttgaagtacctgaattttgccacgttgtacctg
aagatctatcacctgagctacctccacaactgcgagacgcgccgcggccaggtgctgctg
tggtcggccaacaaggtgtttgaggagctgacggacatcgagaggcagttccacaaggcc
ttctacacggtgcgggcctacctcaactgcgagcggtactccgtgggcctcctggacatg
accaaggagaaggaattttttgacgtgtggtctgtgctgatgggagagtcccagccgtac
tcgggcccacgcacgcctgatggccgggaaattgtcttctacaaagtgatcgactacatc
ctccacggcaaggaggagatcaaggtcattcccacaccctcagccgatcactgggccctg
gccagcggccttccaagctacgtggcagaaagcggctttatttgtaacatcatgaatgct
tccgctgacgaaatgttcaaatttcaggaaggggccctggacgactccgggtggctcatc
aagaatgtgctgtccatgcccatcgtcaacaagaaggaggagattgtgggagtcgccaca
ttttacaacaggaaagacgggaagccctttgacgaacaggacgaggttctcatggagtcc
ctgacacagttcctgggctggtcagtgatgaacaccgacacctacgacaagatgaacaag
ctggagaaccgcaaggacatcgcacaggacatggtcctttaccacgtgaagtgcgacagg
gacgagatccagctcatcctgccaaccagagcgcgcctggggaaggagcctgctgactgc
gatgaggacgagctgggcgaaatcctgaaggaggagctgccagggcccaccacatttgac
atctacgaattccacttctctgacctggagtgcaccgaactggacctggtcaaatgtggc
atccagatgtactacgagctgggcgtggtccgaaagttccagatcccccaggaggtcctg
gtgcggttcctgttctccatcagcaaagggtaccggagaatcacctaccacaactggcgc
cacggcttcaacgtggcccagacgatgttcacgctgctcatgaccggcaaactgaagagc
tactacacggacctggaggccttcgccatggtgacagccggcctgtgccatgacatcgac
caccgcggcaccaacaacctgtaccagatgaagtcccagaaccccttggctaagctccac
ggctcctcgattttggagcggcaccacctggagtttgggaagttcctgctctcggaggag
accctgaacatctaccagaacctgaaccggcggcagcacgagcacgtgatccacctgatg
gacatcgccatcatcgccacggacctggccctgtacttcaagaagagagcgatgtttcag
aagatcgtggatgagtccaagaactaccaggacaagaagagctgggtggagtacctgtcc
ctggagacgacccggaaggagatcgtcatggccatgatgatgacagcctgcgacctgtct
gccatcaccaagccctgggaagtccagagcaaggtcgcacttctcgtggctgctgagttc
tgggagcaaggtgacttggaaaggacagtcttggatcagcagcccattcctatgatggac
cggaacaaggcggccgagctccccaagctgcaagtgggcttcatcgacttcgtgtgcaca
ttcgtgtacaaggagttctctcgtttccacgaagagatcctgcccatgttcgaccgactg
cagaacaataggaaagagtggaaggcgctggctgatgagtatgaggccaaagtgaaggct
ctggaggagaaggaggaggaggagagggtggcagccaagaaagtaggcacagaaatttgc
aatggcggcccagcacccaagtcttcaacctgctgtatcctgtga

DBGET integrated database retrieval system