KEGG   Homo sapiens (human): 51588Help
Entry
51588             CDS       T01001                                 

Gene name
PIAS4, PIASY, Piasg, ZMIZ6
Definition
protein inhibitor of activated STAT, 4
Orthology
K16065  
E3 SUMO-protein ligase PIAS4 [EC:6.3.2.-]
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
Ubiquitin mediated proteolysis
Jak-STAT signaling pathway
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:hsa04120]
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:hsa04630]
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:hsa04064]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
19p13.3
AA seq 510 aa AA seqDB search
MAAELVEAKNMVMSFRVSDLQMLLGFVGRSKSGLKHELVTRALQLVQFDCSPELFKKIKE
LYETRYAKKNSEPAPQPHRPLDPLTMHSTYDRAGAVPRTPLAGPNIDYPVLYGKYLNGLG
RLPAKTLKPEVRLVKLPFFNMLDELLKPTELVPQNNEKLQESPCIFALTPRQVELIRNSR
ELQPGVKAVQVVLRICYSDTSCPQEDQYPPNIAVKVNHSYCSVPGYYPSNKPGVEPKRPC
RPINLTHLMYLSSATNRITVTWGNYGKSYSVALYLVRQLTSSELLQRLKTIGVKHPELCK
ALVKEKLRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKK
PTWMCPVCDKPAPYDQLIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQGA
ILVLGPSDANGLLPAPSVNGSGALGSTGGGGPVGSMENGKPGADVVDLTLDSSSSSEDEE
EEEEEEEDEDEEGPRPKRRCPFQKGLVPAC
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggagctggtggaggccaaaaacatggtgatgagttttcgagtctccgacctt
cagatgctcctgggtttcgtgggccggagtaagagtggactgaagcacgagctcgtcacc
agggccctccagctggtgcagtttgactgtagccctgagctgttcaagaagatcaaggag
ctgtacgagacccgctacgccaagaagaactcggagcctgccccacagccgcaccggccc
ctggaccccctgaccatgcactccacctacgaccgggccggcgctgtgcccaggactccg
ctggcaggccccaatattgactaccccgtgctctacggaaagtacttaaacggactggga
cggttgcccgccaagaccctcaagccagaagtccgcctggtgaagctgccgttctttaat
atgctggatgagctgctgaagcccaccgaattagtcccacagaacaacgagaagcttcag
gagagcccgtgcatcttcgcattgacgccaagacaggtggagttgatccggaactccagg
gaactgcagcccggagttaaagccgtgcaggtcgtcctgagaatctgttactcagacacc
agctgccctcaggaggaccagtacccgcccaacatcgctgtgaaggtcaaccacagctac
tgctccgtcccgggctactacccctccaataagcccggggtggagcccaagaggccgtgc
cgccccatcaacctcactcacctcatgtacctgtcctcggccaccaaccgcatcactgtc
acctgggggaactacggcaagagctactcggtggccctgtacctggtgcggcagctgacc
tcatcggagctgctgcagaggctgaagaccattggggtaaagcacccggagctgtgcaag
gcactggtcaaggagaagctgcgccttgatcctgacagcgagatcgccaccaccggtgtg
cgggtgtccctcatctgtccgctggtgaagatgcggctctccgtgccctgccgggcagag
acctgcgcccacctgcagtgcttcgacgccgtcttctacctgcagatgaacgagaagaag
cccacctggatgtgccccgtgtgcgacaagccagccccctacgaccagctcatcatcgac
gggctcctctcgaagatcctgagcgagtgtgaggacgccgacgagatcgagtacctggtg
gacggctcgtggtgcccgatccgcgccgaaaaggagcgcagctgcagcccgcagggcgcc
atcctcgtgctgggcccctcggacgccaatgggctcctgcccgcccccagcgtcaacggg
agcggtgccctgggcagcacgggtggcggcggcccggtgggcagcatggagaatgggaag
ccgggcgccgatgtggtggacctcacgctggacagctcatcgtcctcggaggatgaggag
gaggaggaagaggaggaggaagacgaggacgaagaggggccccggcccaagcgccgctgc
cccttccagaagggcctggtgccggcctgctga

DBGET integrated database retrieval system