KEGG   Homo sapiens (human): 51588Help
Entry
51588             CDS       T01001                                 

Gene name
PIAS4, PIAS-gamma, PIASY, Piasg, ZMIZ6
Definition
(RefSeq) protein inhibitor of activated STAT, 4
  KO
K16065  
E3 SUMO-protein ligase PIAS4
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
Ubiquitin mediated proteolysis
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    51588 (PIAS4)
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    51588 (PIAS4)
   04064 NF-kappa B signaling pathway
    51588 (PIAS4)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   51588 (PIAS4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.3
AA seq 510 aa AA seqDB search
MAAELVEAKNMVMSFRVSDLQMLLGFVGRSKSGLKHELVTRALQLVQFDCSPELFKKIKE
LYETRYAKKNSEPAPQPHRPLDPLTMHSTYDRAGAVPRTPLAGPNIDYPVLYGKYLNGLG
RLPAKTLKPEVRLVKLPFFNMLDELLKPTELVPQNNEKLQESPCIFALTPRQVELIRNSR
ELQPGVKAVQVVLRICYSDTSCPQEDQYPPNIAVKVNHSYCSVPGYYPSNKPGVEPKRPC
RPINLTHLMYLSSATNRITVTWGNYGKSYSVALYLVRQLTSSELLQRLKTIGVKHPELCK
ALVKEKLRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKK
PTWMCPVCDKPAPYDQLIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQGA
ILVLGPSDANGLLPAPSVNGSGALGSTGGGGPVGSMENGKPGADVVDLTLDSSSSSEDEE
EEEEEEEDEDEEGPRPKRRCPFQKGLVPAC
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggagctggtggaggccaaaaacatggtgatgagttttcgagtctccgacctt
cagatgctcctgggtttcgtgggccggagtaagagtggactgaagcacgagctcgtcacc
agggccctccagctggtgcagtttgactgtagccctgagctgttcaagaagatcaaggag
ctgtacgagacccgctacgccaagaagaactcggagcctgccccacagccgcaccggccc
ctggaccccctgaccatgcactccacctacgaccgggccggcgctgtgcccaggactccg
ctggcaggccccaatattgactaccccgtgctctacggaaagtacttaaacggactggga
cggttgcccgccaagaccctcaagccagaagtccgcctggtgaagctgccgttctttaat
atgctggatgagctgctgaagcccaccgaattagtcccacagaacaacgagaagcttcag
gagagcccgtgcatcttcgcattgacgccaagacaggtggagttgatccggaactccagg
gaactgcagcccggagttaaagccgtgcaggtcgtcctgagaatctgttactcagacacc
agctgccctcaggaggaccagtacccgcccaacatcgctgtgaaggtcaaccacagctac
tgctccgtcccgggctactacccctccaataagcccggggtggagcccaagaggccgtgc
cgccccatcaacctcactcacctcatgtacctgtcctcggccaccaaccgcatcactgtc
acctgggggaactacggcaagagctactcggtggccctgtacctggtgcggcagctgacc
tcatcggagctgctgcagaggctgaagaccattggggtaaagcacccggagctgtgcaag
gcactggtcaaggagaagctgcgccttgatcctgacagcgagatcgccaccaccggtgtg
cgggtgtccctcatctgtccgctggtgaagatgcggctctccgtgccctgccgggcagag
acctgcgcccacctgcagtgcttcgacgccgtcttctacctgcagatgaacgagaagaag
cccacctggatgtgccccgtgtgcgacaagccagccccctacgaccagctcatcatcgac
gggctcctctcgaagatcctgagcgagtgtgaggacgccgacgagatcgagtacctggtg
gacggctcgtggtgcccgatccgcgccgaaaaggagcgcagctgcagcccgcagggcgcc
atcctcgtgctgggcccctcggacgccaatgggctcctgcccgcccccagcgtcaacggg
agcggtgccctgggcagcacgggtggcggcggcccggtgggcagcatggagaatgggaag
ccgggcgccgatgtggtggacctcacgctggacagctcatcgtcctcggaggatgaggag
gaggaggaagaggaggaggaagacgaggacgaagaggggccccggcccaagcgccgctgc
cccttccagaagggcctggtgccggcctgctga

DBGET integrated database retrieval system