KEGG   Homo sapiens (human): 51599Help
Entry
51599             CDS       T01001                                 

Gene name
LSR, ILDR3, LISCH7
Definition
(RefSeq) lipolysis stimulated lipoprotein receptor
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.12
AA seq 649 aa AA seqDB search
MQQDGLGVGTRNGSGKGRSVHPSWPWCAPRPLRYFGRDARARRAQTAAMALLAGGLSRGL
GSHPAAAGRDAVVFVWLLLSTWCTAPARAIQVTVSNPYHVVILFQPVTLPCTYQMTSTPT
QPIVIWKYKSFCRDRIADAFSPASVDNQLNAQLAAGNPGYNPYVECQDSVRTVRVVATKQ
GNAVTLGDYYQGRRITITGNADLTFDQTAWGDSGVYYCSVVSAQDLQGNNEAYAELIVLG
RTSGVAELLPGFQAGPIEDWLFVVVVCLAAFLIFLLLGICWCQCCPHTCCCYVRCPCCPD
KCCCPEALYAAGKAATSGVPSIYAPSTYAHLSPAKTPPPPAMIPMGPAYNGYPGGYPGDV
DRSSSAGGQGSYVPLLRDTDSSVASEVRSGYRIQASQQDDSMRVLYYMEKELANFDPSRP
GPPSGRVERAMSEVTSLHEDDWRSRPSRGPALTPIRDEEWGGHSPRSPRGWDQEPAREQA
GGGWRARRPRARSVDALDDLTPPSTAESGSRSPTSNGGRSRAYMPPRSRSRDDLYDQDDS
RDFPRSRDPHYDDFRSRERPPADPRSHHHRTRDPRDNGSRSGDLPYDGRLLEEAVRKKGS
EERRRPHKEEEEEAYYPPAPPPYSETDSQASRERRLKKNLALSRESLVV
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaggacggacttggagtagggacaaggaacggaagtgggaaggggaggagcgtg
cacccctcctggccttggtgcgcgccgcgccccctaaggtactttggaagggacgcgcgg
gccagacgcgcccagacggccgcgatggcgctgttggccggcgggctctccagagggctg
ggctcccacccggccgccgcaggccgggacgcggtcgtcttcgtgtggcttctgcttagc
acctggtgcacagctcctgccagggccatccaggtgaccgtgtccaacccctaccacgtg
gtgatcctcttccagcctgtgaccctgccctgtacctaccagatgacctcgacccccacg
caacccatcgtcatctggaagtacaagtctttctgccgggaccgcatcgccgatgccttc
tccccggccagcgtcgacaaccagctcaatgcccagctggcagccgggaacccaggctac
aacccctacgttgagtgccaggacagcgtgcgcaccgtcagggtcgtggccaccaagcag
ggcaacgctgtgaccctgggagattactaccagggccggaggattaccatcaccggaaat
gctgacctgacctttgaccagacggcgtggggggacagtggtgtgtattactgctccgtg
gtctcagcccaggacctccaggggaacaatgaggcctacgcagagctcatcgtccttggg
aggacctcaggggtggctgagctcttacctggttttcaggcggggcccatagaagactgg
ctcttcgtggttgtggtatgcctggctgccttcctcatcttcctcctcctgggcatctgc
tggtgccagtgctgcccgcacacttgctgctgctacgtcaggtgcccctgctgcccagac
aagtgctgctgccccgaggccctgtatgccgccggcaaagcagccacctcaggtgttccc
agcatttatgcccccagcacctatgcccacctgtctcccgccaagaccccacccccacca
gctatgattcccatgggccctgcctacaacgggtaccctggaggataccctggagacgtt
gacaggagtagctcagctggtggccaaggctcctatgtacccctgcttcgggacacggac
agcagtgtggcctctgaagtccgcagtggctacaggattcaggccagccagcaggacgac
tccatgcgggtcctgtactacatggagaaggagctggccaacttcgacccttctcgacct
ggcccccccagtggccgtgtggagcgggccatgagtgaagtcacctccctccacgaggac
gactggcgatctcggccttcccggggccctgccctcaccccgatccgggatgaggagtgg
ggtggccactccccccggagtcccaggggatgggaccaggagcccgccagggagcaggca
ggcgggggctggcgggccaggcggccccgggcccgctccgtggacgccctggacgacctc
accccgccgagcaccgccgagtcagggagcaggtctcccacgagtaatggtgggagaagc
cgggcctacatgcccccgcggagccgcagccgggacgacctctatgaccaagacgactcg
agggacttcccacgctcccgggacccccactacgacgacttcaggtctcgggagcgccct
cctgccgaccccaggtcccaccaccaccgtacccgggaccctcgggacaacggctccagg
tccggggacctcccctatgatgggcggctactggaggaggctgtgaggaagaaggggtcg
gaggagaggaggagaccccacaaggaggaggaggaagaggcctactacccgcccgcgccg
cccccgtactcggagaccgactcgcaggcgtcccgagagcgcaggctcaagaagaacttg
gccctgagtcgggaaagtttagtcgtctga

DBGET integrated database retrieval system