KEGG   Homo sapiens (human): 51602Help
Entry
51602             CDS       T01001                                 

Gene name
NOP58, HSPC120, NOP5, NOP5/NOP58
Definition
(RefSeq) NOP58 ribonucleoprotein
  KO
K14565  
nucleolar protein 58
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    51602 (NOP58)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Sno RNPs
   Box C/D snoRNPs
    51602 (NOP58)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q33.1
AA seq 529 aa AA seqDB search
MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF
TALMEGKINKQLKKVLKKIVKEAHEPLAVADAKLGGVIKEKLNLSCIHSPVVNELMRGIR
SQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELNNYI
MRCREWYGWHFPELGKIISDNLTYCKCLQKVGDRKNYASAKLSELLPEEVEAEVKAAAEI
SMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMAIAPNVTVMVGELVGARLIA
HAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLIYHASLVGQTSPKHKGKISR
MLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDRGIRKISGTGKALAKTEKYE
HKSEVKTYDPSGDSTLPTCSKKRKIEQVDKEDEITEKKAKKAKIKVKVEEEEEEKVAEEE
ETSVKKKKKRGKKKHIKEEPLSEEEPCTSTAIASPEKKKKKKKKRENED
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgttggtgctgtttgaaacgtctgtgggttacgccatctttaaggttctaaatgagaag
aaacttcaagaggttgatagtttatggaaagaatttgaaactccagagaaagcaaacaaa
atagtaaagctaaaacattttgagaaatttcaggatacagcagaagcattagcagcattc
acagctctgatggagggcaaaatcaataagcagctgaaaaaagttctgaagaaaatagta
aaagaagcccatgaaccgctggcagtagctgatgctaaactaggaggggtcataaaggaa
aagctgaatctcagttgtatccatagtcctgttgttaatgaacttatgagaggaattcgt
tcacaaatggatggattaatccctggggtagaaccacgtgaaatggcagctatgtgtctt
ggattggctcacagcctgtctcgatatagattgaagtttagcgctgataaagtagacaca
atgattgttcaggcaatttccttgttagatgacttggataaagaactaaacaactacatt
atgcgatgtagagaatggtatggctggcatttccctgaattaggaaaaattatttcagat
aatttaacatactgcaagtgtttacagaaagttggcgataggaagaactatgcctctgcc
aagctttctgagttgctgccagaagaagttgaagcagaagtgaaagcagctgcagagata
tcaatgggaacagaggtttcagaagaagatatttgcaatattctgcatctttgcacccag
gtgattgaaatctctgaatatcgaacccagctctatgaatatctacaaaatcgaatgatg
gccattgcacccaatgttacagtcatggttggggaattagttggagcacggcttattgct
catgcaggttctcttttaaatttggccaagcatgcagcttctaccgttcagattcttgga
gctgaaaaggcacttttcagagccctcaaatctagacgggatacccctaagtatggtctc
atttatcatgcttcactcgtgggccagacaagtcccaaacacaaaggaaagatttctcga
atgctggcagccaaaaccgttttggctatccgttatgatgcttttggtgaggattcaagt
tctgcaatgggagttgagaacagagccaaattagaggccaggttgagaactttggaagac
agagggataagaaaaataagtggaacaggaaaagcattagcaaaaacagaaaaatatgaa
cacaaaagtgaagtgaagacttacgatccttctggtgactccacacttccaacctgttct
aaaaaacgcaaaatagaacaggtagataaagaggatgaaattactgaaaagaaagccaaa
aaagccaagattaaagttaaagttgaagaagaggaagaagaaaaagtggcagaagaagaa
gaaacatctgtgaagaagaagaagaaaaggggtaaaaagaaacacattaaggaagaacca
ctttctgaggaagaaccatgtaccagcacagcaattgctagtccagagaaaaagaagaaa
aagaaaaaaaagagagagaacgaggattaa

DBGET integrated database retrieval system