KEGG   Homo sapiens (human): 5161Help
Entry
5161              CDS       T01001                                 

Gene name
PDHA2, PDHAL
Definition
pyruvate dehydrogenase (lipoamide) alpha 2 (EC:1.2.4.1)
Orthology
K00161  
pyruvate dehydrogenase E1 component subunit alpha [EC:1.2.4.1]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
HIF-1 signaling pathway
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    5161 (PDHA2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    5161 (PDHA2)
   00020 Citrate cycle (TCA cycle)
    5161 (PDHA2)
   00620 Pyruvate metabolism
    5161 (PDHA2)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    5161 (PDHA2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     5161 (PDHA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q22-q23
AA seq 388 aa AA seqDB search
MLAAFISRVLRRVAQKSARRVLVASRNSSNDATFEIKKCDLYLLEEGPPVTTVLTRAEGL
KYYRMMLTVRRMELKADQLYKQKFIRGFCHLCDGQEACCVGLEAGINPSDHVITSYRAHG
VCYTRGLSVRSILAELTGRRGGCAKGKGGSMHMYTKNFYGGNGIVGAQGPLGAGIALACK
YKGNDEICLTLYGDGAANQGQIAEAFNMAALWKLPCVFICENNLYGMGTSTERAAASPDY
YKRGNFIPGLKVDGMDVLCVREATKFAANYCRSGKGPILMELQTYRYHGHSMSDPGVSYR
TREEIQEVRSKRDPIIILQDRMVNSKLATVEELKEIGAEVRKEIDDAAQFATTDPEPHLE
ELGHHIYSSDSSFEVRGANPWIKFKSVS
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgctggccgccttcatctcccgcgtgttgaggcgagttgcccagaaatcagctcgcaga
gtgctggtggcatcccgtaactcctcaaatgacgctacatttgaaattaagaaatgtgat
ctttatctgttggaagagggtccccctgtcactacagtgctcactagggcggaggggctt
aaatactacaggatgatgctgactgttcgccgcatggaattgaaggcagatcagctgtac
aaacagaaattcattcgcggtttctgtcacctgtgcgatggtcaggaagcttgttgcgtg
ggccttgaggccggcataaacccctcggatcacgtcattacatcctatagggctcatggt
gtgtgctatactcggggactttctgtccgatccattctcgcagagctgacgggaagaaga
ggaggttgtgctaaaggaaaaggaggatcgatgcatatgtataccaagaacttctatggg
ggcaatggcatcgtcggtgcacagggccccctgggcgctggcattgctctggcctgtaaa
tataaaggaaacgatgagatctgtttgactttatatggggatggcgctgcgaatcagggg
cagatagccgaagctttcaatatggcagctttatggaaattaccttgtgttttcatctgt
gagaataacctatatggaatgggaacatctactgagagagcagcagccagccctgattac
tacaagaggggcaattttatccctgggctaaaggtcgatggaatggatgttctgtgtgtt
cgtgaggcaacaaaatttgcagctaactactgtagatctggaaaggggcccatactgatg
gagctgcaaacctaccgttatcatggacacagtatgagtgatcctggagtcagttatcgt
acacgagaagaaattcaggaagtaagaagtaagagggatcctataataattctccaagat
agaatggtaaacagcaagctcgccactgtggaagaattaaaggaaattggggctgaggtg
aggaaagaaattgatgatgctgcccagtttgctaccactgatcctgagccacatttggaa
gaattaggccatcacatctacagcagtgattcatcttttgaagttcgtggtgcaaatcca
tggatcaagtttaagtccgtcagttaa

DBGET integrated database retrieval system