KEGG   Homo sapiens (human): 51619Help
Entry
51619             CDS       T01001                                 

Gene name
UBE2D4, HBUCE1
Definition
ubiquitin-conjugating enzyme E2D 4 (putative) (EC:6.3.2.19)
Orthology
K06689  
ubiquitin-conjugating enzyme E2 D/E [EC:6.3.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    51619 (UBE2D4)
   04120 Ubiquitin mediated proteolysis
    51619 (UBE2D4)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.19  ubiquitin---protein ligase
     51619 (UBE2D4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7p13
AA seq 147 aa AA seqDB search
MALKRIQKELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDY
PFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLV
PEIAHTYKADREKYNRLAREWTQKYAM
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggcgctaaagcggatccagaaggaattaaccgacttgcagagggatcctcctgcccag
tgttctgcaggacctgtcggtgatgacttgttccactggcaggccaccatcatgggcccg
aatgacagtccttaccaaggaggtgttttcttcctgaccatccactttcctacagattac
ccgttcaagcccccaaaggttgctttcacaaccaaaatttatcaccctaatatcaacagc
aatggcagcatctgccttgatatcctgcggtctcagtggtctccagcgttgactgtgtca
aaagttctcttgtccatctgctcgctgctctgcgaccccaaccccgatgaccccctggtg
ccagagatagcacacacctacaaggccgacagagagaagtacaacagactagcaagagag
tggacacaaaaatatgctatgtaa

DBGET integrated database retrieval system