KEGG   Homo sapiens (human): 51619Help
Entry
51619             CDS       T01001                                 

Gene name
UBE2D4, HBUCE1
Definition
(RefSeq) ubiquitin-conjugating enzyme E2D 4 (putative) (EC:6.3.2.19)
  KO
K06689  
ubiquitin-conjugating enzyme E2 D/E [EC:2.3.2.23]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    51619 (UBE2D4)
   04120 Ubiquitin mediated proteolysis
    51619 (UBE2D4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     51619 (UBE2D4)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   51619 (UBE2D4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7p13
AA seq 147 aa AA seqDB search
MALKRIQKELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDY
PFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLV
PEIAHTYKADREKYNRLAREWTQKYAM
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggcgctaaagcggatccagaaggaattaaccgacttgcagagggatcctcctgcccag
tgttctgcaggacctgtcggtgatgacttgttccactggcaggccaccatcatgggcccg
aatgacagtccttaccaaggaggtgttttcttcctgaccatccactttcctacagattac
ccgttcaagcccccaaaggttgctttcacaaccaaaatttatcaccctaatatcaacagc
aatggcagcatctgccttgatatcctgcggtctcagtggtctccagcgttgactgtgtca
aaagttctcttgtccatctgctcgctgctctgcgaccccaaccccgatgaccccctggtg
ccagagatagcacacacctacaaggccgacagagagaagtacaacagactagcaagagag
tggacacaaaaatatgctatgtaa

DBGET integrated database retrieval system