KEGG   Homo sapiens (human): 5162Help
Entry
5162              CDS       T01001                                 

Gene name
PDHB, PDHBD, PDHE1-B, PHE1B
Definition
pyruvate dehydrogenase (lipoamide) beta (EC:1.2.4.1)
Orthology
K00162  
pyruvate dehydrogenase E1 component subunit beta [EC:1.2.4.1]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
HIF-1 signaling pathway
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Disease
H00072  
Pyruvate dehydrogenase complex deficiency
Class
Metabolism; Overview; Carbon metabolism [PATH:hsa01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hsa00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:hsa00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:hsa00620]
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:hsa04066]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p21.1-p14.2
AA seq 359 aa AA seqDB search
MAAVSGLVRRPLREVSGLLKRRFHWTAPAALQVTVRDAINQGMDEELERDEKVFLLGEEV
AQYDGAYKVSRGLWKKYGDKRIIDTPISEMGFAGIAVGAAMAGLRPICEFMTFNFSMQAI
DQVINSAAKTYYMSGGLQPVPIVFRGPNGASAGVAAQHSQCFAAWYGHCPGLKVVSPWNS
EDAKGLIKSAIRDNNPVVVLENELMYGVPFEFPPEAQSKDFLIPIGKAKIERQGTHITVV
SHSRPVGHCLEAAAVLSKEGVECEVINMRTIRPMDMETIEASVMKTNHLVTVEGGWPQFG
VGAEICARIMEGPAFNFLDAPAVRVTGADVPMPYAKILEDNSIPQVKDIIFAIKKTLNI
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtgtctggcttggtgcggagaccccttcgggaggtctccgggctgctgaag
aggcgctttcactggaccgcgccggctgcgctgcaggtgacagttcgtgatgctataaat
cagggtatggatgaggagctggaaagagatgagaaggtatttctgcttggagaagaagtt
gcccagtatgatggggcatacaaggttagtcgagggctgtggaagaaatatggagacaag
aggattattgacactcccatatcagagatgggctttgctggaattgctgtaggtgcagct
atggctgggttgcggcccatttgtgaatttatgaccttcaatttctccatgcaagccatt
gaccaggttataaactcagctgccaagacctactacatgtctggtggccttcagcctgtg
cctatagtcttcagggggcccaatggtgcctcagcaggtgtagctgcccagcactcacag
tgctttgctgcctggtatgggcactgcccaggcttaaaggtggtcagtccctggaattca
gaggatgctaaaggacttattaaatcagccattcgggataacaatccagtggtggtgcta
gagaatgaattgatgtatggggttccttttgaatttcctccggaagctcagtcaaaagat
tttctgattcctattggaaaagccaaaatagaaaggcaaggaacacatataactgtggtt
tcccattcaagacctgtgggccactgcttagaagctgcagcagtgctatctaaagaagga
gttgaatgtgaggtgataaatatgcgtaccattagaccaatggacatggaaaccatagaa
gccagtgtcatgaagacaaatcatcttgtaactgtggaaggaggctggccacagtttgga
gtaggagctgaaatctgtgccaggatcatggaaggtcctgcgttcaatttcctggatgct
cctgctgttcgtgtcactggtgctgatgtccctatgccttatgcaaagattctagaggac
aactctatacctcaggtcaaagacatcatatttgcaataaagaaaacattaaatatttag

DBGET integrated database retrieval system