KEGG   Homo sapiens (human): 5163Help
Entry
5163              CDS       T01001                                 

Gene name
PDK1
Definition
pyruvate dehydrogenase kinase, isozyme 1 (EC:2.7.11.2)
Orthology
K12077  
pyruvate dehydrogenase kinase isoform 1 [EC:2.7.11.2]
Organism
hsa  Homo sapiens (human)
Pathway
HIF-1 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    5163 (PDK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     5163 (PDK1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   5163 (PDK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q31.1
AA seq 456 aa AA seqDB search
MRLARLLRGAALAGPGPGLRAAGFSRSFSSDSGSSPASERGVPGQVDFYARFSPSPLSMK
QFLDFGSVNACEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQE
LLDFKDKSAEDAKAIYERPRRTWLQVSSLCCMACKMIFTDTVIRIRNRHNDVIPTMAQGV
IEYKESFGVDPVTSQNVQYFLDRFYMSRISIRMLLNQHSLLFGGKGKGSPSHRKHIGSIN
PNCNVLEVIKDGYENARRLCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFEL
FKNAMRATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAP
RPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERL
PVYNKAAWKHYNTNHEADDWCVPSREPKDMTTFRSA
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgaggctggcgcggctgcttcgcggagccgccttggccggcccgggcccggggctgcgc
gccgccggcttcagccgcagcttcagctcggactcgggctccagcccggcgtccgagcgc
ggcgttccgggccaggtggacttctacgcgcgcttctcgccgtccccgctctccatgaag
cagttcctggacttcggatcagtgaatgcttgtgaaaagacctcatttatgtttctgcgg
caagagttgcctgtcagactggcaaatataatgaaagaaataagtctccttccagataat
cttctcaggacaccatccgttcaattggtacaaagctggtatatccagagtcttcaggag
cttcttgattttaaggacaaaagtgctgaggatgctaaagctatttatgaaaggcctaga
agaacatggttgcaggtctctagtttatgctgtatggcctgcaagatgatctttacagat
actgtgatacggatcagaaaccgacacaatgatgtcattcccacaatggcccagggtgtg
attgaatacaaggagagctttggggtggatcctgtcaccagccagaatgttcagtacttt
ttggatcgattctacatgagtcgcatttcaattagaatgttactcaatcagcactcttta
ttgtttggtggaaaaggcaaaggaagtccatctcatcgaaaacacattggaagcataaat
ccaaactgcaatgtacttgaagttattaaagatggctatgaaaatgctaggcgtctgtgt
gatttgtattatattaactctcccgaactagaacttgaagaactaaatgcaaaatcacca
ggacagccaatacaagtggtttatgtaccatcccatctctatcacatggtgtttgaactt
ttcaagaatgcaatgagagccactatggaacaccatgccaacagaggtgtttacccccct
attcaagttcatgtcacgctgggtaatgaggatttgactgtgaagatgagtgaccgagga
ggtggcgttcctttgaggaaaattgacagacttttcaactacatgtattcaactgcacca
agacctcgtgttgagacctcccgcgcagtgcctctggctggttttggttatggattgccc
atatcacgtctttacgcacaatacttccaaggagacctgaagctgtattccctagagggt
tacgggacagatgcagttatctacattaaggctctgtcaacagactcaatagaaagactc
ccagtgtataacaaagctgcctggaagcattacaacaccaaccacgaggctgatgactgg
tgcgtccccagcagagaacccaaagacatgacgacgttccgcagtgcctag

DBGET integrated database retrieval system