KEGG   Homo sapiens (human): 5164Help
Entry
5164              CDS       T01001                                 

Gene name
PDK2, PDHK2, PDKII
Definition
(RefSeq) pyruvate dehydrogenase kinase 2
  KO
K00898  pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     5164 (PDK2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  PDHK family [OT]
   5164 (PDK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BCDHK_Adom3 HATPase_c HATPase_c_3
Motif
Other DBs
NCBI-GeneID: 5164
NCBI-ProteinID: NP_002602
OMIM: 602525
HGNC: 8810
Ensembl: ENSG00000005882
Vega: OTTHUMG00000161948
Pharos: Q15119(Tbio)
UniProt: Q15119
Structure
PDB: 

Jmol
Position
17q21.33
AA seq 407 aa AA seqDB search
MRWVWALLKNASLAGAPKYIEHFSKFSPSPLSMKQFLDFGSSNACEKTSFTFLRQELPVR
LANIMKEINLLPDRVLSTPSVQLVQSWYVQSLLDIMEFLDKDPEDHRTLSQFTDALVTIR
NRHNDVVPTMAQGVLEYKDTYGDDPVSNQNIQYFLDRFYLSRISIRMLINQHTLIFDGST
NPAHPKHIGSIDPNCNVSEVVKDAYDMAKLLCDKYYMASPDLEIQEINAANSKQPIHMVY
VPSHLYHMLFELFKNAMRATVESHESSLILPPIKVMVALGEEDLSIKMSDRGGGVPLRKI
ERLFSYMYSTAPTPQPGTGGTPLAGFGYGLPISRLYAKYFQGDLQLFSMEGFGTDAVIYL
KALSTDSVERLPVYNKSAWRHYQTIQEAGDWCVPSTEPKNTSTYRVS
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgcgctgggtgtgggcgctgctgaagaatgcgtccctggcaggggcgcccaagtacata
gagcacttcagcaagttctccccgtccccgctgtccatgaagcagtttctggacttcgga
tccagcaatgcctgtgagaaaacctccttcaccttcctcaggcaggagctgcctgtgcgc
ctggccaacatcatgaaagagatcaacctgcttcccgaccgagtgctgagcacaccctcc
gtgcagctggtgcagagctggtatgtccagagcctcctggacatcatggagttcctggac
aaggatcccgaggaccatcgcaccctgagccagttcactgacgccctggtcaccatccgg
aaccggcacaacgacgtggtgcccaccatggcacaaggcgtgcttgagtacaaggacacc
tacggcgatgaccccgtctccaaccagaacatccagtacttcctggaccgcttctacctc
agccgcatctccatccgcatgctcatcaaccagcacaccctcatctttgatggcagcacc
aacccagcccatcccaaacacatcggcagcatcgaccccaactgcaacgtctctgaggtg
gtcaaagatgcctacgacatggctaagctcctgtgtgacaagtattacatggcctcacct
gacctggagatccaggagatcaatgcagccaactccaaacagccgattcacatggtctac
gtcccctcccacctctaccacatgctctttgagctcttcaagaatgccatgagggcgact
gtggaaagccatgagtccagcctcattctcccacccatcaaggtcatggtggccttgggt
gaggaagatctgtccatcaagatgagtgaccgaggtgggggtgttcccttgaggaagatt
gagcgactcttcagctacatgtactccacagcacccaccccccagcctggcaccggggga
acgccgctggctggctttggttatgggctccccatttcccgcctctacgccaagtacttc
cagggagacctgcagctcttctccatggaaggctttgggaccgatgctgtcatctatctc
aaggccctgtccacggactcggtggagcgcctgcctgtctacaacaagtcagcctggcgc
cactaccagaccatccaggaggccggcgactggtgtgtgcccagcacggagcccaagaac
acgtccacgtaccgcgtcagctaa

DBGET integrated database retrieval system