KEGG   Homo sapiens (human): 5167Help
Entry
5167              CDS       T01001                                 

Gene name
ENPP1, ARHR2, COLED, M6S1, NPP1, NPPS, PC-1, PCA1, PDNP1
Definition
(RefSeq) ectonucleotide pyrophosphatase/phosphodiesterase 1
  KO
K01513  
ectonucleotide pyrophosphatase/phosphodiesterase family member 1/3 [EC:3.1.4.1 3.6.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Pyrimidine metabolism
Starch and sucrose metabolism
Nicotinate and nicotinamide metabolism
Pantothenate and CoA biosynthesis
Metabolic pathways
Disease
H00214  
Hypophosphatemic rickets
H00409  
Type II diabetes mellitus
H00431  
Ossification of the posterior longitudinal ligament of spine (OPLL)
H01002  
Generalized arterial calcification of infancy
H01394  
Cole disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    5167 (ENPP1)
  Nucleotide metabolism
   00230 Purine metabolism
    5167 (ENPP1)
   00240 Pyrimidine metabolism
    5167 (ENPP1)
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    5167 (ENPP1)
   00770 Pantothenate and CoA biosynthesis
    5167 (ENPP1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.1  phosphodiesterase I
     5167 (ENPP1)
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.9  nucleotide diphosphatase
     5167 (ENPP1)
Cellular antigens [BR:hsa04090]
 Proteins
  5167 (ENPP1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Enzymes
  5167 (ENPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6q22-q23
AA seq 925 aa AA seqDB search
MERDGCAGGGSRGGEGGRAPREGPAGNGRDRGRSHAAEAPGDPQAAASLLAPMDVGEEPL
EKAARARTAKDPNTYKVLSLVLSVCVLTTILGCIFGLKPSCAKEVKSCKGRCFERTFGNC
RCDAACVELGNCCLDYQETCIEPEHIWTCNKFRCGEKRLTRSLCACSDDCKDKGDCCINY
SSVCQGEKSWVEEPCESINEPQCPAGFETPPTLLFSLDGFRAEYLHTWGGLLPVISKLKK
CGTYTKNMRPVYPTKTFPNHYSIVTGLYPESHGIIDNKMYDPKMNASFSLKSKEKFNPEW
YKGEPIWVTAKYQGLKSGTFFWPGSDVEINGIFPDIYKMYNGSVPFEERILAVLQWLQLP
KDERPHFYTLYLEEPDSSGHSYGPVSSEVIKALQRVDGMVGMLMDGLKELNLHRCLNLIL
ISDHGMEQGSCKKYIYLNKYLGDVKNIKVIYGPAARLRPSDVPDKYYSFNYEGIARNLSC
REPNQHFKPYLKHFLPKRLHFAKSDRIEPLTFYLDPQWQLALNPSERKYCGSGFHGSDNV
FSNMQALFVGYGPGFKHGIEADTFENIEVYNLMCDLLNLTPAPNNGTHGSLNHLLKNPVY
TPKHPKEVHPLVQCPFTRNPRDNLGCSCNPSILPIEDFQTQFNLTVAEEKIIKHETLPYG
RPRVLQKENTICLLSQHQFMSGYSQDILMPLWTSYTVDRNDSFSTEDFSNCLYQDFRIPL
SPVHKCSFYKNNTKVSYGFLSPPQLNKNSSGIYSEALLTTNIVPMYQSFQVIWRYFHDTL
LRKYAEERNGVNVVSGPVFDFDYDGRCDSLENLRQKRRVIRNQEILIPTHFFIVLTSCKD
TSQTPLHCENLDTLAFILPHRTDNSESCVHGKHDSSWVEELLMLHRARITDVEHITGLSF
YQQRKEPVSDILKLKTHLPTFSQED
NT seq 2778 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcgacggctgcgcggggggcgggagccgcggcggcgagggcgggcgcgctccc
cgggagggcccggcggggaacggccgcgatcggggccgcagccacgctgccgaggcgccc
ggggacccgcaggcggccgcgtccttgctggcccctatggacgtgggggaggagccgctg
gagaaggcggcgcgcgcccgcactgccaaggaccccaacacctataaagtactctcgctg
gtattgtcagtatgtgtgttaacaacaatacttggttgtatatttgggttgaaaccaagc
tgtgccaaagaagttaaaagttgcaaaggtcgctgtttcgagagaacatttgggaactgt
cgctgtgatgctgcctgtgttgagcttggaaactgctgtttagattaccaggagacgtgc
atagaaccagaacatatatggacttgcaacaaattcaggtgtggtgagaaaaggttgacc
agaagcctctgtgcctgttcagatgactgcaaggacaagggcgactgctgcatcaactac
agttctgtgtgtcaaggtgagaaaagttgggtagaagaaccatgtgagagcattaatgag
ccacagtgcccagcagggtttgaaacgcctcctaccctcttattttctttggatggattc
agggcagaatatttacacacttggggtggacttcttcctgttattagcaaactaaaaaaa
tgtggaacatatactaaaaacatgagaccggtatatccaacaaaaactttccccaatcac
tacagcattgtcaccggattgtatccagaatctcatggcataatcgacaataaaatgtat
gatcccaaaatgaatgcttccttttcacttaaaagtaaagagaaatttaatcctgagtgg
tacaaaggagaaccaatttgggtcacagctaagtatcaaggcctcaagtctggcacattt
ttctggccaggatcagatgtggaaattaacggaattttcccagacatctataaaatgtat
aatggttcagtaccatttgaagaaaggattttagctgttcttcagtggctacagcttcct
aaagatgaaagaccacacttttacactctgtatttagaagaaccagattcttcaggtcat
tcatatggaccagtcagcagtgaagtcatcaaagccttgcagagggttgatggtatggtt
ggtatgctgatggatggtctgaaagagctgaacttgcacagatgcctgaacctcatcctt
atttcagatcatggcatggaacaaggcagttgtaagaaatacatatatctgaataaatat
ttgggggatgttaaaaatattaaagttatctatggacctgcagctcgattgagaccctct
gatgtcccagataaatactattcatttaactatgaaggcattgcccgaaatctttcttgc
cgggaaccaaaccagcacttcaaaccttacctgaaacatttcttacctaagcgtttgcac
tttgctaagagtgatagaattgagcccttgacattctatttggaccctcagtggcaactt
gcattgaatccctcagaaaggaaatattgtggaagtggatttcatggctctgacaatgta
ttttcaaatatgcaagccctctttgttggctatggacctggattcaagcatggcattgag
gctgacacctttgaaaacattgaagtctataacttaatgtgtgatttactgaatttgaca
ccggctcctaataacggaactcatggaagtcttaaccaccttctaaagaatcctgtttat
acgccaaagcatcccaaagaagtgcaccccctggtacagtgccccttcacaagaaacccc
agagataaccttggctgctcatgtaacccttcgattttgccgattgaggattttcaaaca
cagttcaatctgactgtggcagaagagaagattattaagcatgaaactttaccctatgga
agacctagagttctccagaaggaaaacaccatctgtcttctttcccagcaccagtttatg
agtggatacagccaagacatcttaatgcccctttggacatcctataccgtggacagaaat
gacagtttctctacggaagacttctccaactgtctgtaccaggactttagaattcctctt
agtcctgtccataaatgttcattttataaaaataacaccaaagtgagttacgggttcctc
tccccaccacaactaaataaaaattcaagtggaatatattctgaagctttgcttactaca
aatatagtgccaatgtaccagagttttcaagttatatggcgctactttcatgacacccta
ctgcgaaagtatgctgaagaaagaaatggtgtcaatgtcgtcagtggtcctgtgtttgac
tttgattatgatggacgttgtgattccttagagaatctgaggcaaaaaagaagagtcatc
cgtaaccaagaaattttgattccaactcacttctttattgtgctaacaagctgtaaagat
acatctcagacgcctttgcactgtgaaaacctagacaccttagctttcattttgcctcac
aggactgataacagcgagagctgtgtgcatgggaagcatgactcctcatgggttgaagaa
ttgttaatgttacacagagcacggatcacagatgttgagcacatcactggactcagcttc
tatcaacaaagaaaagagccagtttcagacattttaaagttgaaaacacatttgccaacc
tttagccaagaagactga

DBGET integrated database retrieval system