KEGG   Homo sapiens (human): 51676Help
Entry
51676             CDS       T01001                                 

Gene name
ASB2, ASB-2
Definition
(RefSeq) ankyrin repeat and SOCS box containing 2
  KO
K10324  
ankyrin repeat and SOCS box protein 2
Organism
hsa  Homo sapiens (human)
Brite
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     51676 (ASB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q32.12
AA seq 587 aa AA seqDB search
MTRFSYAEYFSLFHSCSAPSRSTAPPESSPARAPMGLFQGVMQKYSSSLFKTSQLAPADP
LIKAIKDGDEEALKTMIKEGKNLAEPNKEGWLPLHEAAYYGQVGCLKVLQRAYPGTIDQR
TLQEETAVYLATCRGHLDCLLSLLQAGAEPDISNKSRETPLYKACERKNAEAVKILVQHN
ADTNHRCNRGWTALHESVSRNDLEVMQILVSGGAKVESKNAYGITPLFVAAQSGQLEALR
FLAKYGADINTQASDNASALYEACKNEHEEVVEFLLSQGADANKTNKDGLLPLHIASKKG
NYRIVQMLLPVTSRTRIRRSGVSPLHLAAERNHDEVLEALLSARFDVNTPLAPERARLYE
DRRSSALYFAVVNNNVYATELLLQHGADPNRDVISPLLVAIRHGCLRTMQLLLDHGANID
AYIATHPTAFPATIMFAMKCLSLLKFLMDLGCDGEPCFSCLYGNGPHPPAPQPSSRFNDA
PAADKEPSVVQFCEFVSAPEVSRWAGPIIDVLLDYVGNVQLCSRLKEHIDSFEDWAVIKE
KAEPPRPLAHLCRLRVRKAIGKYRIKLLDTLPLPGRLIRYLKYENTQ
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcttctcctatgcagagtacttttccctctttcactcctgctctgcaccctcc
aggtccactgcacctcctgagagttcgccggcccgggccccaatgggcttgttccaaggg
gtcatgcagaaatacagcagcagcttgttcaagacctcccagctggcgcctgcggacccc
ttgataaaggccatcaaggatggcgatgaagaggccttgaagaccatgatcaaggaaggg
aagaatctcgcagagcccaacaaggagggctggctgccgctgcacgaggccgcatactat
ggccaggtgggctgcctgaaagtcctgcagcgagcgtacccagggaccatcgaccagcgc
accctgcaggaggaaacagccgtttacttggcaacgtgcaggggccacctggactgtctc
ctgtcactgctccaagcaggggcagagccggacatctccaacaaatcccgagagacaccg
ctctacaaagcctgcgagcgcaagaacgcggaggccgtgaagattctggtgcagcacaat
gcagacaccaaccaccgctgcaaccgcggctggaccgctctgcacgagtctgtgtctcgc
aatgacctggaggtcatgcagatcctggtgagcggaggagccaaggtggaatccaagaac
gcctacggcatcacccccttgttcgtggccgcccagagtggacagttggaggccttgagg
ttcttagccaagtacggtgctgacatcaacacgcaggccagcgacaacgcgtctgccctc
tacgaggcctgcaagaatgagcatgaggaggtggtggagtttctgctgtcacagggtgcc
gacgccaacaagaccaacaaggacggcttgctcccgctgcacatcgcctccaagaagggc
aactacaggatcgtgcagatgctgctgccggtgaccagccgcacgcgcatacgccgtagc
ggcgtcagtccgctgcacctggcggccgagcgcaaccacgacgaggtgctggaggcgctg
ctgagcgcgcgcttcgacgtgaacacgccgctggcccccgagcgcgcgcgcctctacgaa
gaccggcgcagctccgcgctgtacttcgcggtggtcaacaacaacgtgtacgccaccgag
ctgctgctgcaacacggcgccgaccccaaccgcgacgtcatcagccccttgctcgtggcc
atccgccacggctgcctgcgcacaatgcagctgctgctggaccacggcgcgaacatcgac
gcctatatcgccacgcaccccaccgccttccccgccaccatcatgttcgccatgaagtgc
ctgtcgctgctcaagttcctcatggacctgggctgcgacggcgagccctgcttctcatgc
ctctacggcaacggcccgcacccgccggccccgcagccctccagcaggttcaacgacgcg
cccgcggccgacaaggagcccagcgtggtgcagttctgtgagttcgtatctgccccagag
gtgagccgctgggcggggcccatcatcgatgtcctcctggactacgtgggcaacgtgcag
ctctgctcgcggctgaaggaacacatcgacagctttgaggactgggccgtcatcaaggag
aaggcagaacctccaagacctctggctcacctttgccgactgcgggttcgaaaggccatt
gggaaataccgtataaaactcctagacaccttgccgctcccaggcaggctgattagatac
ctgaaatacgagaacacccagtaa

DBGET integrated database retrieval system