KEGG   Homo sapiens (human): 51678Help
Entry
51678             CDS       T01001                                 

Gene name
MPP6, PALS2, VAM-1, VAM1, p55T
Definition
(RefSeq) membrane palmitoylated protein 6
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7p15
AA seq 540 aa AA seqDB search
MQQVLENLTELPSSTGAEEIDLIFLKGIMENPIVKSLAKAHERLEDSKLEAVSDNNLELV
NEILEDITPLINVDENVAELVGILKEPHFQSLLEAHDIVASKCYDSPPSSPEMNNSSINN
QLLPVDAIRILGIHKRAGEPLGVTFRVENNDLVIARILHGGMIDRQGLLHVGDIIKEVNG
HEVGNNPKELQELLKNISGSVTLKILPSYRDTITPQQVFVKCHFDYNPYNDNLIPCKEAG
LKFSKGEILQIVNREDPNWWQASHVKEGGSAGLIPSQFLEEKRKAFVRRDWDNSGPFCGT
ISSKKKKKMMYLTTRNAEFDRHEIQIYEEVAKMPPFQRKTLVLIGAQGVGRRSLKNRFIV
LNPTRFGTTVPFTSRKPREDEKDGQAYKFVSRSEMEADIKAGKYLEHGEYEGNLYGTKID
SILEVVQTGRTCILDVNPQALKVLRTSEFMPYVVFIAAPELETLRAMHKAVVDAGITTKL
LTDSDLKKTVDESARIQRAYNHYFDLIIINDNLDKAFEKLQTAIEKLRMEPQWVPISWVY
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaagtcttggaaaaccttacggagctgccctcgtctactggagcagaagaaata
gacctaattttcctcaagggaattatggagaatcctattgtaaaatcacttgctaaggct
catgagaggctagaagattccaaactagaagctgtcagtgacaataacttggaattagtc
aatgaaattcttgaagacatcactcctctaataaatgtggatgaaaatgtggcagaattg
gttggtatactcaaagaacctcacttccagtcactgttggaggcccatgatattgtggca
tcaaagtgttatgattcacctccatcaagcccagaaatgaataattcttctatcaataat
cagttattaccagtagatgccattcgtattcttggtattcacaaaagagctggggaacca
ctgggtgtgacatttagggttgaaaataatgatctggtaattgcccgaatcctccatggg
ggaatgatagatcgacaaggtctacttcatgtgggagatataattaaagaagtcaatggc
catgaggttggaaataatccaaaggaattacaagaattactgaaaaatattagtggaagt
gtcaccctaaaaatcttaccaagttatagagataccattactcctcaacaggtatttgtg
aagtgtcattttgattataatccatacaatgacaacctaataccttgcaaagaagcagga
ttgaagttttccaaaggagagattcttcagattgtaaatagagaagatccaaattggtgg
caggctagccatgtaaaagagggaggaagcgctggtctcattccaagccagttcctggaa
gagaagagaaaggcatttgttagaagagactgggacaattcaggacctttttgtggaact
ataagtagcaaaaaaaagaaaaagatgatgtatctcacaaccagaaatgcagaatttgat
cgtcatgaaatccagatatatgaggaggtagccaaaatgcctcccttccagagaaaaaca
ttagtattgataggagctcaaggtgtaggccgaagaagcttgaaaaacaggttcatagta
ttgaatcccactagatttggaactacggtgccatttacttcacggaaaccaagggaagat
gaaaaagatggccaggcatataagtttgtgtcacgatctgagatggaagcagatattaaa
gctggaaagtatttggaacatggggaatatgaaggaaatctctatggaaccaaaattgat
tctattcttgaggttgtccaaactggacggacttgcattctggatgtcaacccacaagca
ctgaaagtattgaggacatcagagtttatgccctatgtggtatttattgcggctccggag
ctagagacgttacgtgccatgcacaaggctgtggtggatgcaggaatcactaccaagctt
ctgaccgactctgacttgaagaaaacagtggatgaaagtgcacggattcagagagcatac
aaccactattttgatttgatcatcataaatgataatctagacaaagcctttgaaaaactg
caaactgccatagagaaactgagaatggaaccacagtgggtcccaatcagctgggtttac
tga

DBGET integrated database retrieval system