KEGG   Homo sapiens (human): 517Help
Entry
517               CDS       T01001                                 

Gene name
ATP5G2, ATP5A
Definition
ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C2 (subunit 9)
Orthology
K02128  
F-type H+-transporting ATPase subunit c
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    517 (ATP5G2)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    517 (ATP5G2)
   05012 Parkinson's disease
    517 (ATP5G2)
   05016 Huntington's disease
    517 (ATP5G2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q13.13
AA seq 157 aa AA seqDB search
MPELILSPATAPHPLKMFACSKFVSTPSLVKSTSQLLSRPLSAVVLKRPEILTDESLSSL
AVSCPLTSLVSSRSFQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYAR
NPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagctgatcctctctcctgccacagctcctcaccccctgaaaatgttcgcctgc
tccaagtttgtctccactccctccttggtcaagagcacctcacagctgctgagccgtccg
ctatctgcagtggtgctgaaacgaccggagatactgacagatgagagcctcagcagcttg
gcagtctcatgtccccttacctcacttgtctctagccgcagcttccaaaccagcgccatt
tcaagggacatcgacacagcagccaagttcattggagctggggctgccacagttggggtg
gctggttctggggctgggattggaactgtgtttgggagcctcatcattggttatgccagg
aacccttctctgaagcaacagctcttctcctacgccattctgggctttgccctctcggag
gccatggggctcttttgtctgatggtagcctttctcatcctctttgccatgtga

DBGET integrated database retrieval system