KEGG   Homo sapiens (human): 5170Help
Entry
5170              CDS       T01001                                 

Gene name
PDPK1, PDK1, PDPK2, PRO0461
Definition
3-phosphoinositide dependent protein kinase 1 (EC:2.7.11.1)
Orthology
K06276  
3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
PPAR signaling pathway
FoxO signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Focal adhesion
T cell receptor signaling pathway
Fc epsilon RI signaling pathway
Neurotrophin signaling pathway
Insulin signaling pathway
Thyroid hormone signaling pathway
Aldosterone-regulated sodium reabsorption
Toxoplasmosis
Hepatitis C
Proteoglycans in cancer
Endometrial cancer
Prostate cancer
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    5170 (PDPK1)
   04151 PI3K-Akt signaling pathway
    5170 (PDPK1)
   04152 AMPK signaling pathway
    5170 (PDPK1)
   04150 mTOR signaling pathway
    5170 (PDPK1)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    5170 (PDPK1)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    5170 (PDPK1)
   04664 Fc epsilon RI signaling pathway
    5170 (PDPK1)
  Endocrine system
   04910 Insulin signaling pathway
    5170 (PDPK1)
   03320 PPAR signaling pathway
    5170 (PDPK1)
   04919 Thyroid hormone signaling pathway
    5170 (PDPK1)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    5170 (PDPK1)
  Nervous system
   04722 Neurotrophin signaling pathway
    5170 (PDPK1)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    5170 (PDPK1)
   05215 Prostate cancer
    5170 (PDPK1)
   05213 Endometrial cancer
    5170 (PDPK1)
   05223 Non-small cell lung cancer
    5170 (PDPK1)
  Infectious diseases
   05160 Hepatitis C
    5170 (PDPK1)
   05145 Toxoplasmosis
    5170 (PDPK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     5170 (PDPK1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: AGC group
  PKB family
   5170 (PDPK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16p13.3
AA seq 454 aa AA seqDB search
MARTTSQLYDAVPIQSSVVLCSCPSPSMVRTQTESSTPPGIPGGSRQGPAMDGTAAEPRP
GAGSLQHAQPPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIK
ENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDET
CTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARAN
SFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYD
FPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLTA
YLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSSSSHSLSASDTGLPQRSGSNIEQYIHDLD
SNSFELDLQFSEDEKRLLLEKQAGGNPCLTGRII
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggccaggaccaccagccagctgtatgacgccgtgcccatccagtccagcgtggtgtta
tgttcctgcccatccccatcaatggtgaggacccagactgagtccagcacgccccctggc
attcctggtggcagcaggcagggccccgccatggacggcactgcagccgagcctcggccc
ggcgccggctccctgcagcatgcccagcctccgccgcagcctcggaagaagcggcctgag
gacttcaagtttgggaaaatccttggggaaggctctttttccacggttgtcctggctcga
gaactggcaacctccagagaatatgcgattaaaattctggagaagcgacatatcataaaa
gagaacaaggtcccctatgtaaccagagagcgggatgtcatgtcgcgcctggatcacccc
ttctttgttaagctttacttcacatttcaggacgacgagaagctgtatttcggccttagt
tatgccaaaaatggagaactacttaaatatattcgcaaaatcggttcattcgatgagacc
tgtacccgattttacacggctgagattgtgtctgctttagagtacttgcacggcaagggc
atcattcacagggaccttaaaccggaaaacattttgttaaatgaagatatgcacatccag
atcacagattttggaacagcaaaagtcttatccccagagagcaaacaagccagggccaac
tcattcgtgggaacagcgcagtacgtttctccagagctgctcacggagaagtccgcctgt
aagagttcagacctttgggctcttggatgcataatataccagcttgtggcaggactccca
ccattccgagctggaaacgagtatcttatatttcagaagatcattaagttggaatatgac
tttccagaaaaattcttccctaaggcaagagacctcgtggagaaacttttggttttagat
gccacaaagcggttaggctgtgaggaaatggaaggatacggacctcttaaagcacacccg
ttcttcgagtccgtcacgtgggagaacctgcaccagcagacgcctccgaagctcaccgct
tacctgccggctatgtcggaagacgacgaggactgctatggcaattatgacaatctcctg
agccagtttggctgcatgcaggtgtcttcgtcctcctcctcacactccctgtcagcctcc
gacacgggcctgccccagaggtcaggcagcaacatagagcagtacattcacgatctggac
tcgaactcctttgaactggacttacagttttccgaagatgagaagaggttgttgttggag
aagcaggctggcggaaacccttgcctaacaggacgtattatctga

DBGET integrated database retrieval system