KEGG   Homo sapiens (human): 51700Help
Entry
51700             CDS       T01001                                 

Gene name
CYB5R2, B5R.2
Definition
cytochrome b5 reductase 2 (EC:1.6.2.2)
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
hsa  Homo sapiens (human)
Pathway
Amino sugar and nucleotide sugar metabolism
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:hsa00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p15.4
AA seq 276 aa AA seqDB search
MNSRRREPITLQDPEAKYPLPLIEKEKISHNTRRFRFGLPSPDHVLGLPVGNYVQLLAKI
DNELVVRAYTPVSSDDDRGFVDLIIKIYFKNVHPQYPEGGKMTQYLENMKIGETIFFRGP
RGRLFYHGPGNLGIRPDQTSEPKKTLADHLGMIAGGTGITPMLQLIRHITKDPSDRTRMS
LIFANQTEEDILVRKELEEIARTHPDQFNLWYTLDRPPIGWKYSSGFVTADMIKEHLPPP
AKSTLILVCGPPPLIQTAAHPNLEKLGYTQDMIFTY
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaactccaggaggagagagccaatcaccttacaggaccctgaagccaagtacccgctg
cccttgattgagaaagagaaaatcagccacaacacccggaggttccgctttggactgcct
tcgccggaccatgtcttagggcttcctgtaggtaactatgtccagctcttggcaaaaatc
gataatgaattggtggtcagggcttacacccctgtctccagtgatgatgacagaggcttt
gtggacctaattataaagatctacttcaaaaatgtacacccccaatatcctgaaggtggg
aagatgactcagtatttggagaacatgaaaatcggggagaccatcttttttcgagggcca
aggggacgcttgttttaccatgggccagggaatcttggaatcagaccagaccagacgagt
gagcctaaaaaaacactggccgatcacctgggaatgattgctgggggcacaggcatcaca
cccatgttgcagctcattcgccacatcaccaaggaccccagtgacaggaccaggatgtcc
ctcatctttgccaaccagacagaggaggatatcttggtcagaaaagagcttgaagaaatt
gccaggactcacccagaccagttcaacctgtggtacaccctggacaggcctcccattggc
tggaagtacagctcaggcttcgttactgccgacatgatcaaggagcaccttcctcctcca
gcgaagtccacgctcatcctggtgtgtggcccgccaccactaatccagacggcggctcac
cctaacctggagaagctgggttatacccaggacatgattttcacctactaa

DBGET integrated database retrieval system