KEGG   Homo sapiens (human): 51700Help
Entry
51700             CDS       T01001                                 

Gene name
CYB5R2, B5R.2
Definition
(RefSeq) cytochrome b5 reductase 2
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    51700 (CYB5R2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     51700 (CYB5R2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_6 NAD_binding_1 NAD_binding_6 FAD_binding_9
Motif
Other DBs
NCBI-GeneID: 51700
NCBI-ProteinID: NP_001289755
OMIM: 608342
HGNC: 24376
Ensembl: ENSG00000166394
Vega: OTTHUMG00000165665
Pharos: Q6BCY4(Tdark)
UniProt: Q6BCY4 A8K237
Position
11p15.4
AA seq 276 aa AA seqDB search
MNSRRREPITLQDPEAKYPLPLIEKEKISHNTRRFRFGLPSPDHVLGLPVGNYVQLLAKI
DNELVVRAYTPVSSDDDRGFVDLIIKIYFKNVHPQYPEGGKMTQYLENMKIGETIFFRGP
RGRLFYHGPGNLGIRPDQTSEPKKTLADHLGMIAGGTGITPMLQLIRHITKDPSDRTRMS
LIFANQTEEDILVRKELEEIARTHPDQFNLWYTLDRPPIGWKYSSGFVTADMIKEHLPPP
AKSTLILVCGPPPLIQTAAHPNLEKLGYTQDMIFTY
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaactccaggaggagagagccaatcaccttacaggaccctgaagccaagtacccgctg
cccttgattgagaaagagaaaatcagccacaacacccggaggttccgctttggactgcct
tcgccggaccatgtcttagggcttcctgtaggtaactatgtccagctcttggcaaaaatc
gataatgaattggtggtcagggcttacacccctgtctccagtgatgatgacagaggcttt
gtggacctaattataaagatctacttcaaaaatgtacacccccaatatcctgaaggtggg
aagatgactcagtatttggagaacatgaaaatcggggagaccatcttttttcgagggcca
aggggacgcttgttttaccatgggccagggaatcttggaatcagaccagaccagacgagt
gagcctaaaaaaacactggccgatcacctgggaatgattgctgggggcacaggcatcaca
cccatgttgcagctcattcgccacatcaccaaggaccccagtgacaggaccaggatgtcc
ctcatctttgccaaccagacagaggaggatatcttggtcagaaaagagcttgaagaaatt
gccaggactcacccagaccagttcaacctgtggtacaccctggacaggcctcccattggc
tggaagtacagctcaggcttcgttactgccgacatgatcaaggagcaccttcctcctcca
gcgaagtccacgctcatcctggtgtgtggcccgccaccactaatccagacggcggctcac
cctaacctggagaagctgggttatacccaggacatgattttcacctactaa

DBGET integrated database retrieval system