KEGG   Homo sapiens (human): 51701Help
Entry
51701             CDS       T01001                                 

Gene name
NLK
Definition
nemo-like kinase (EC:2.7.11.24)
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Wnt signaling pathway
Adherens junction
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:hsa04310]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:hsa04068]
Cellular Processes; Cell communication; Adherens junction [PATH:hsa04520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q11.2
AA seq 527 aa AA seqDB search
MSLCGARANAKMMAAYNGGTSAAAAGHHHHHHHHLPHLPPPHLHHHHHPQHHLHPGSAAA
VHPVQQHTSSAAAAAAAAAAAAAMLNPGQQQPYFPSPAPGQAPGPAAAAPAQVQAAAAAT
VKAHHHQHSHHPQQQLDIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCK
RVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDH
VKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQE
VVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTP
SLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKD
ALAHPYLDEGRLRYHTCMCKCCFSTSTGRVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEI
IHQFILEQQKGNRVPLCINPQSAAFKSFISSTVAQPSEMPPSPLVWE
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgtctctttgtggcgcaagagccaacgcaaaaatgatggcggcttacaatggcggtaca
tctgcagcagcagcaggtcaccaccaccaccatcaccaccaccttccacacctccctcct
cctcacctgcaccaccaccaccaccctcaacaccatcttcatccggggtcggctgccgct
gtacaccctgtacagcagcacacctcttcggcagctgcggcagccgcagcagcggctgca
gctgcagccatgttaaaccctgggcaacaacagccatatttcccatcaccggcaccgggg
caggctcctggaccagctgcagcagccccagctcaggtacaggctgccgcagctgctaca
gttaaggcgcaccatcatcagcactcgcatcatccacagcagcagctggatattgagccg
gatagacctattggatatggagcctttggtgttgtctggtcagtaacagatccaagagat
ggaaagagagtagcgctcaaaaagatgcccaacgtcttccagaatctggtctcttgcaaa
agggtcttccgggaattgaagatgttgtgtttttttaagcatgataatgtactctctgcc
cttgacatactccaacctccacacattgactattttgaagaaatatatgttgtcacagaa
ttgatgcagagtgacctacataaaattatcgtctctcctcaaccactcagctcagatcat
gtcaaagtttttctttatcagattttgcgaggtttgaaatatctccattcagctggcatt
ttacatcgagacattaagccagggaatctccttgtgaacagcaactgtgttctaaagatt
tgtgattttggattggccagagtggaagaattagatgaatcccgtcatatgactcaggaa
gttgttactcagtattatcgggctccagaaatcctgatgggcagccgtcattacagcaat
gctattgacatctggtctgtgggatgtatctttgcagaactactaggacgaagaatattg
tttcaggcacagagtcccattcagcagttggatttgatcacggatctgttgggcacacca
tcactggaagcaatgaggacagcttgtgaaggcgctaaggcacatatactcaggggtcct
cataaacagccatctcttcctgtactctataccctgtctagccaggctacacatgaagct
gttcatctcctttgcaggatgttggtctttgatccatccaaaagaatatccgctaaggat
gccttagcccacccctacctagatgaagggcgactacgatatcacacatgtatgtgtaaa
tgttgcttttccacctccactggaagagtttataccagtgactttgagcctgtcaccaat
cccaaatttgatgacactttcgagaagaacctcagttctgtccgacaggttaaagaaatt
attcatcagttcattttggaacagcagaaaggaaacagagtgcctctctgcatcaaccct
cagtctgctgcttttaagagctttattagttccactgttgctcagccatctgagatgccc
ccatctcctctggtgtgggagtga

DBGET integrated database retrieval system