KEGG   Homo sapiens (human): 51703Help
Entry
51703             CDS       T01001                                 

Gene name
ACSL5, ACS2, ACS5, FACL5
Definition
(RefSeq) acyl-CoA synthetase long chain family member 5
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00061  Fatty acid biosynthesis
hsa00071  Fatty acid degradation
hsa01100  Metabolic pathways
hsa01212  Fatty acid metabolism
hsa03320  PPAR signaling pathway
hsa04146  Peroxisome
hsa04216  Ferroptosis
hsa04714  Thermogenesis
hsa04920  Adipocytokine signaling pathway
Module
hsa_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00061 Fatty acid biosynthesis
    51703 (ACSL5)
   00071 Fatty acid degradation
    51703 (ACSL5)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    51703 (ACSL5)
  Cell growth and death
   04216 Ferroptosis
    51703 (ACSL5)
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    51703 (ACSL5)
   03320 PPAR signaling pathway
    51703 (ACSL5)
  Environmental adaptation
   04714 Thermogenesis
    51703 (ACSL5)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     51703 (ACSL5)
Lipid biosynthesis proteins [BR:hsa01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   51703 (ACSL5)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   51703 (ACSL5)
  Exosomal proteins of breast cancer cells
   51703 (ACSL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 51703
NCBI-ProteinID: NP_976313
OMIM: 605677
HGNC: 16526
Ensembl: ENSG00000197142
Vega: OTTHUMG00000019060
Pharos: Q9ULC5(Tbio)
UniProt: Q9ULC5
Position
10q25.2
AA seq 683 aa AA seqDB search
MLFIFNFLFSPLPTPALICILTFGAAIFLWLITRPQPVLPLLDLNNQSVGIEGGARKGVS
QKNNDLTSCCFSDAKTMYEVFQRGLAVSDNGPCLGYRKPNQPYRWLSYKQVSDRAEYLGS
CLLHKGYKSSPDQFVGIFAQNRPEWIISELACYTYSMVAVPLYDTLGPEAIVHIVNKADI
AMVICDTPQKALVLIGNVEKGFTPSLKVIILMDPFDDDLKQRGEKSGIEILSLYDAENLG
KEHFRKPVPPSPEDLSVICFTSGTTGDPKGAMITHQNIVSNAAAFLKCVEHAYEPTPDDV
AISYLPLAHMFERIVQAVVYSCGARVGFFQGDIRLLADDMKTLKPTLFPAVPRLLNRIYD
KVQNEAKTPLKKFLLKLAVSSKFKELQKGIIRHDSFWDKLIFAKIQDSLGGRVRVIVTGA
APMSTSVMTFFRAAMGCQVYEAYGQTECTGGCTFTLPGDWTSGHVGVPLACNYVKLEDVA
DMNYFTVNNEGEVCIKGTNVFKGYLKDPEKTQEALDSDGWLHTGDIGRWLPNGTLKIIDR
KKNIFKLAQGEYIAPEKIENIYNRSQPVLQIFVHGESLRSSLVGVVVPDTDVLPSFAAKL
GVKGSFEELCQNQVVREAILEDLQKIGKESGLKTFEQVKAIFLHPEPFSIENGLLTPTLK
AKRGELSKYFRTQIDSLYEHIQD
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgctttttatctttaactttttgttttccccacttccgaccccggcgttgatctgcatc
ctgacatttggagctgccatcttcttgtggctgatcaccagacctcaacccgtcttacct
cttcttgacctgaacaatcagtctgtgggaattgagggaggagcacggaagggggtttcc
cagaagaacaatgacctaacaagttgctgcttctcagatgccaagactatgtatgaggtt
ttccaaagaggactcgctgtgtctgacaatgggccctgcttgggatatagaaaaccaaac
cagccctacagatggctatcttacaaacaggtgtctgatagagcagagtacctgggttcc
tgtctcttgcataaaggttataaatcatcaccagaccagtttgtcggcatctttgctcag
aataggccagagtggatcatctccgaattggcttgttacacgtactctatggtagctgta
cctctgtatgacaccttgggaccagaagccatcgtacatattgtcaacaaggctgatatc
gccatggtgatctgtgacacaccccaaaaggcattggtgctgatagggaatgtagagaaa
ggcttcaccccgagcctgaaggtgatcatccttatggacccctttgatgatgacctgaag
caaagaggggagaagagtggaattgagatcttatccctatatgatgctgagaacctaggc
aaagagcacttcagaaaacctgtgcctcctagcccagaagacctgagcgtcatctgcttc
accagtgggaccacaggtgaccccaaaggagccatgataacccatcaaaatattgtttca
aatgctgctgcctttctcaaatgtgtggagcatgcttatgagcccactcctgatgatgtg
gccatatcctacctccctctggctcatatgtttgagaggattgtacaggctgttgtgtac
agctgtggagccagagttggattcttccaaggggatattcggttgctggctgacgacatg
aagactttgaagcccacattgtttcccgcggtgcctcgactccttaacaggatctacgat
aaggtacaaaatgaggccaagacacccttgaagaagttcttgttgaagctggctgtttcc
agtaaattcaaagagcttcaaaagggtatcatcaggcatgatagtttctgggacaagctc
atctttgcaaagatccaggacagcctgggcggaagggttcgtgtaattgtcactggagct
gcccccatgtccacttcagtcatgacattcttccgggcagcaatgggatgtcaggtgtat
gaagcttatggtcaaacagaatgcacaggtggctgtacatttacattacctggggactgg
acatcaggtcacgttggggtgcccctggcttgcaattacgtgaagctggaagatgtggct
gacatgaactactttacagtgaataatgaaggagaggtctgcatcaagggtacaaacgtg
ttcaaaggatacctgaaggaccctgagaagacacaggaagccctggacagtgatggctgg
cttcacacaggagacattggtcgctggctcccgaatggaactctgaagatcatcgaccgt
aaaaagaacattttcaagctggcccaaggagaatacattgcaccagagaagatagaaaat
atctacaacaggagtcaaccagtgttacaaatttttgtacacggggagagcttacggtca
tccttagtaggagtggtggttcctgacacagatgtacttccctcatttgcagccaagctt
ggggtgaagggctcctttgaggaactgtgccaaaaccaagttgtaagggaagccatttta
gaagacttgcagaaaattgggaaagaaagtggccttaaaacttttgaacaggtcaaagcc
atttttcttcatccagagccattttccattgaaaatgggctcttgacaccaacattgaaa
gcaaagcgaggagagctttccaaatactttcggacccaaattgacagcctgtatgagcac
atccaggattag

DBGET integrated database retrieval system