KEGG   Homo sapiens (human): 51706Help
Entry
51706             CDS       T01001                                 

Gene name
CYB5R1, B5R.1, B5R1, B5R2, NQO3A2, humb5R2
Definition
cytochrome b5 reductase 1 (EC:1.6.2.2)
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
hsa  Homo sapiens (human)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    51706 (CYB5R1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     51706 (CYB5R1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q32.1
AA seq 305 aa AA seqDB search
MGIQTSPVLLASLGVGLVTLLGLAVGSYLVRRSRRPQVTLLDPNEKYLLRLLDKTTVSHN
TKRFRFALPTAHHTLGLPVGKHIYLSTRIDGSLVIRPYTPVTSDEDQGYVDLVIKVYLKG
VHPKFPEGGKMSQYLDSLKVGDVVEFRGPSGLLTYTGKGHFNIQPNKKSPPEPRVAKKLG
MIAGGTGITPMLQLIRAILKVPEDPTQCFLLFANQTEKDIILREDLEELQARYPNRFKLW
FTLDHPPKDWAYSKGFVTADMIREHLPAPGDDVLVLLCGPPPMVQLACHPNLDKLGYSQK
MRFTY
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggggatccagacgagccccgtcctgctggcctccctgggggtggggctggtcactctg
ctcggcctggctgtgggctcctacttggttcggaggtcccgccggcctcaggtcactctc
ctggaccccaatgaaaagtacctgctacgactgctagacaagacgactgtgagccacaac
accaagaggttccgctttgccctgcccaccgcccaccacactctggggctgcctgtgggc
aaacatatctacctctccacccgaattgatggcagcctggtcatcaggccatacactcct
gtcaccagtgatgaggatcaaggctatgtggatcttgtcatcaaggtctacctgaagggt
gtgcaccccaaatttcctgagggagggaagatgtctcagtacctggatagcctgaaggtt
ggggatgtggtggagtttcgggggccaagcgggttgctcacttacactggaaaagggcat
tttaacattcagcccaacaagaaatctccaccagaaccccgagtggcgaagaaactggga
atgattgccggcgggacaggaatcaccccaatgctacagctgatccgggccatcctgaaa
gtccctgaagatccaacccagtgctttctgctttttgccaaccagacagaaaaggatatc
atcttgcgggaggacttagaggaactgcaggcccgctatcccaatcgctttaagctctgg
ttcactctggatcatcccccaaaagattgggcctacagcaagggctttgtgactgccgac
atgatccgggaacacctgcccgctccaggggatgatgtgctggtactgctttgtgggcca
cccccaatggtgcagctggcctgccatcccaacttggacaaactgggctactcacaaaag
atgcgattcacctactga

DBGET integrated database retrieval system