KEGG   Homo sapiens (human): 51719Help
Entry
51719             CDS       T01001                                 

Gene name
CAB39, CGI-66, MO25
Definition
(RefSeq) calcium binding protein 39
  KO
K08272  
calcium binding protein 39
Organism
hsa  Homo sapiens (human)
Pathway
mTOR signaling pathway
AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    51719 (CAB39)
   04150 mTOR signaling pathway
    51719 (CAB39)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q37.1
AA seq 341 aa AA seqDB search
MPFPFGKSHKSPADIVKNLKESMAVLEKQDISDKKAEKATEEVSKNLVAMKEILYGTNEK
EPQTEAVAQLAQELYNSGLLSTLVADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYI
CTQQNILFMLLKGYESPEIALNCGIMLRECIRHEPLAKIILWSEQFYDFFRYVEMSTFDI
ASDAFATFKDLLTRHKLLSAEFLEQHYDRFFSEYEKLLHSENYVTKRQSLKLLGELLLDR
HNFTIMTKYISKPENLKLMMNLLRDKSRNIQFEAFHVFKVFVANPNKTQPILDILLKNQA
KLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRPAQQEA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgccgttcccgtttgggaagtctcacaaatctccagcagacattgtgaagaatctgaag
gagagcatggctgttctggaaaagcaagacatttctgataaaaaagcagaaaaggctaca
gaagaagtttccaaaaatctggttgccatgaaagaaattctgtatggcacaaatgaaaaa
gagcctcagacagaagcagtagctcaacttgctcaagaactctataatagtgggctcctt
agcaccctggtagctgatttacagctcattgactttgagggcaaaaaagacgtggctcaa
attttcaacaatattctcagaagacaaattggtacgagaactcctactgttgaatacatc
tgcacccaacagaatattttgttcatgttattgaaagggtatgaatctccagaaatagct
ctaaattgtggaataatgttaagagaatgcatcagacatgaaccacttgcaaaaatcatt
ttgtggtcggaacagttttatgatttcttcagatatgtcgaaatgtcaacatttgacata
gcttcagatgcatttgccacattcaaggatttacttacaagacataaattgctcagtgca
gaatttttggaacagcattatgatagatttttcagtgaatatgagaagttacttcattca
gaaaattatgtgacaaaaagacagtcactgaagcttctcggtgaactactactagataga
cacaacttcacaattatgacaaaatacatcagtaaacctgagaacctcaaattaatgatg
aacctgctgcgagacaaaagtcgcaacatccagtttgaggcctttcacgtttttaaggtg
tttgtagccaatcctaacaagacgcagcccatcctagacatcctcctcaagaaccaggcc
aaactcatagagttcctcagcaagtttcagaacgacaggacggaggatgagcagtttaac
gacgagaagacctatttagttaaacagatcagggatttgaagagaccagctcagcaagaa
gcttaa

DBGET integrated database retrieval system