KEGG   Homo sapiens (human): 51719Help
Entry
51719             CDS       T01001                                 

Gene name
CAB39, MO25
Definition
calcium binding protein 39
Orthology
K08272  
calcium binding protein 39
Organism
hsa  Homo sapiens (human)
Pathway
mTOR signaling pathway
Class
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:hsa04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q37.1
AA seq 341 aa AA seqDB search
MPFPFGKSHKSPADIVKNLKESMAVLEKQDISDKKAEKATEEVSKNLVAMKEILYGTNEK
EPQTEAVAQLAQELYNSGLLSTLVADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYI
CTQQNILFMLLKGYESPEIALNCGIMLRECIRHEPLAKIILWSEQFYDFFRYVEMSTFDI
ASDAFATFKDLLTRHKLLSAEFLEQHYDRFFSEYEKLLHSENYVTKRQSLKLLGELLLDR
HNFTIMTKYISKPENLKLMMNLLRDKSRNIQFEAFHVFKVFVANPNKTQPILDILLKNQA
KLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRPAQQEA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgccgttcccgtttgggaagtctcacaaatctccagcagacattgtgaagaatctgaag
gagagcatggctgttctggaaaagcaagacatttctgataaaaaagcagaaaaggctaca
gaagaagtttccaaaaatctggttgccatgaaagaaattctgtatggcacaaatgaaaaa
gagcctcagacagaagcagtagctcaacttgctcaagaactctataatagtgggctcctt
agcaccctggtagctgatttacagctcattgactttgagggcaaaaaagacgtggctcaa
attttcaacaatattctcagaagacaaattggtacgagaactcctactgttgaatacatc
tgcacccaacagaatattttgttcatgttattgaaagggtatgaatctccagaaatagct
ctaaattgtggaataatgttaagagaatgcatcagacatgaaccacttgcaaaaatcatt
ttgtggtcggaacagttttatgatttcttcagatatgtcgaaatgtcaacatttgacata
gcttcagatgcatttgccacattcaaggatttacttacaagacataaattgctcagtgca
gaatttttggaacagcattatgatagatttttcagtgaatatgagaagttacttcattca
gaaaattatgtgacaaaaagacagtcactgaagcttctcggtgaactactactagataga
cacaacttcacaattatgacaaaatacatcagtaaacctgagaacctcaaattaatgatg
aacctgctgcgagacaaaagtcgcaacatccagtttgaggcctttcacgtttttaaggtg
tttgtagccaatcctaacaagacgcagcccatcctagacatcctcctcaagaaccaggcc
aaactcatagagttcctcagcaagtttcagaacgacaggacggaggatgagcagtttaac
gacgagaagacctatttagttaaacagatcagggatttgaagagaccagctcagcaagaa
gcttaa

DBGET integrated database retrieval system