KEGG   Homo sapiens (human): 51726Help
Entry
51726             CDS       T01001                                 

Gene name
DNAJB11, ABBP-2, ABBP2, DJ9, Dj-9, EDJ, ERdj3, ERj3, ERj3p, PRO1080, UNQ537
Definition
DnaJ (Hsp40) homolog, subfamily B, member 11
Orthology
K09517  
DnaJ homolog subfamily B member 11
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    51726 (DNAJB11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
3q27.3
AA seq 358 aa AA seqDB search
MAPQNLSTFCLLLLYLIGAVIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDD
PQAQEKFQDLGAAYEVLSDSEKRKQYDTYGEEGLKDGHQSSHGDIFSHFFGDFGFMFGGT
PRQQDRNIPRGSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQL
GPGRFQMTQEVVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLR
FRIKVVKHPIFERRGDDLYTNVTISLVESLVGFEMDITHLDGHKVHISRDKITRPGAKLW
KKGEGLPNFDNNNIKGSLIITFDVDFPKEQLTEEAREGIKQLLKQGSVQKVYNGLQGY
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggctccgcagaacctgagcaccttttgcctgttgctgctatacctcatcggggcggtg
attgccggacgagatttctataagatcttgggggtgcctcgaagtgcctctataaaggat
attaaaaaggcctataggaaactagccctgcagcttcatcccgaccggaaccctgatgat
ccacaagcccaggagaaattccaggatctgggtgctgcttatgaggttctgtcagatagt
gagaaacggaaacagtacgatacttatggtgaagaaggattaaaagatggtcatcagagc
tcccatggagacattttttcacacttctttggggattttggtttcatgtttggaggaacc
cctcgtcagcaagacagaaatattccaagaggaagtgatattattgtagatctagaagtc
actttggaagaagtatatgcaggaaattttgtggaagtagttagaaacaaacctgtggca
aggcaggctcctggcaaacggaagtgcaattgtcggcaagagatgcggaccacccagctg
ggccctgggcgcttccaaatgacccaggaggtggtctgcgacgaatgccctaatgtcaaa
ctagtgaatgaagaacgaacgctggaagtagaaatagagcctggggtgagagacggcatg
gagtacccctttattggagaaggtgagcctcacgtggatggggagcctggagatttacgg
ttccgaatcaaagttgtcaagcacccaatatttgaaaggagaggagatgatttgtacaca
aatgtgacaatctcattagttgagtcactggttggctttgagatggatattactcacttg
gatggtcacaaggtacatatttcccgggataagatcaccaggccaggagcgaagctatgg
aagaaaggggaagggctccccaactttgacaacaacaatatcaagggctctttgataatc
acttttgatgtggattttccaaaagaacagttaacagaggaagcgagagaaggtatcaaa
cagctactgaaacaagggtcagtgcagaaggtatacaatggactgcaaggatattga

DBGET integrated database retrieval system